SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014676 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014676
Domain Number 1 Region: 343-473
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-39
Family C-type lectin domain 0.00012
Further Details:      
 
Domain Number 2 Region: 151-329
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-35
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 3 Region: 485-621
Classification Level Classification E-value
Superfamily C-type lectin-like 7.46e-34
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 4 Region: 927-1078
Classification Level Classification E-value
Superfamily C-type lectin-like 8.29e-34
Family C-type lectin domain 0.00082
Further Details:      
 
Domain Number 5 Region: 785-913
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-32
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 6 Region: 632-771
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-30
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 7 Region: 1095-1208
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-26
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-20
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 9 Region: 6-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000286
Family Cysteine rich domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014676   Gene: ENSTNIG00000011725   Transcript: ENSTNIT00000014876
Sequence length 1443
Comment pep:known_by_projection chromosome:TETRAODON8:3:13433969:13444134:1 gene:ENSTNIG00000011725 transcript:ENSTNIT00000014876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPLDSDDVAFYHDGAGGCLGVLDHSLILSSACEDANQRWKWVTRNRLFNLGSSLCLGMT
PGNLTSRDDEPVLGVYTCDREPPKVRLTWKCDQVLDHIHDCLPYPSLLNYTSPFVVFSLA
NKWGLHGGVRNLCSKTSRDIYTIQGNSHGRPCYFPFLYDGQWFHNCTSIGREDGHLWCAT
TSDYGKDELWGFCPVKSTTCETFWEKDPVTDSCYQFNFQAKLSWTEAWVSCQQQGADLLS
VTKLHEQTYINGLLTSYSAALWIGLNDRDVQGGWQWSDSSPLKYLNWETDQPKHDDEHNC
AVIRTESSGRWQNRVCSDTLPYVCKKRPNATMDPFTTDSWSNDENYECDMGWQAFQASCY
KLNSEKTEWATAQKTCQKMEANLVSIHTLPELEFITGTMKKDVEQLWIGLHDTNMQMDFQ
WTDHTPVIFTFWHPFEPNNFRNTPEDCVSLWGAAGRWDDSPCNLTLPSVCKKLGTKSDGK
PQQECKQGWKWHSPACYWVGEDLLTFDEAKSACKGYGAALVTITNRFEQAFANSLVFGRS
GDSFWIGLSDQGSRNSFHWLSGDEVSYTNWNRDQPVKIHDDGCVSMATGFATGLWEVMEC
ASSKAKFICRQNQGTSVSPEPAAPQPTPSLSGSCPNGWKSNSNLRYCYKVFHSSQPEQKL
SWLQAHLFCQRHGANLLSIGSPDEEHFVLQVLHEAFGESEDHEQHWFWIGLNRRNPMDNG
SWKWSDGLAYTYQNFGRYYYNIRQCAAADLGSETWLAMHCDSELDWICKIPRGSPEKEPE
VSEEPSSPHWIGFQEAEYKFYDHRTTWDQAQRICSWFASSLASVHSAEEEAFLANTLRKM
DKSAGDKWWLGLQTYENDGRFRWSDHSVLNYVSWALGRPHPLSRDRKCVYLSAEKADWSD
QKCYSDLPYICKRVNVTGTIPPTPASPHPPSGCPDGWSSYQHKCFRVFAQPNRVTWSAAK
LKCETQRGVLAVVSNHLEQAFITTLLNDAIVDLWVGLTSDAKGHFQWARPGLLSYTNWAP
GEPLDNSGPHHNRTPGNCVVMNHGNPLKSAGMWASRACEMENNGYICQRQQDSDLPPAPP
LIPASLSKPVELGRMTYRVVEKRLDWTGALHLCESLNGTLARVKNPHEQAYLTLLINSLR
RPAWIALYSYGGRSFTWLGEQEIFYSNWKDGQPNQMAGCGHMTTSGQWTVTPCDAKLDAA
ICEISDAPLVHQWTYAGQCPHILGDWAWVPRNHCYAFNLHSLKLQQEARQSCKKVGAELL
SILDETENGFIWEHIQSYAEQAYGAWLGISVKGRVPAAGRGLVWSEEEEMSYSNWETHDV
ALSVLSPNSCFWIQSNSGLWKPGSCRNRTHGVICKKPRESEARPLLSPAPARGDHLPTLI
VVSVASLLLLALIAVVIYLHRRRTVGSRGSYEGARYSRTSSSLTEQTEKNILVSDMELNE
QAE
Download sequence
Identical sequences H3D2D8
ENSTNIP00000014676 ENSTNIP00000014676 99883.ENSTNIP00000014676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]