SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014706 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014706
Domain Number 1 Region: 458-589
Classification Level Classification E-value
Superfamily PX domain 1.7e-20
Family PX domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014706   Gene: ENSTNIG00000011754   Transcript: ENSTNIT00000014906
Sequence length 877
Comment pep:known_by_projection chromosome:TETRAODON8:7:5592008:5596134:-1 gene:ENSTNIG00000011754 transcript:ENSTNIT00000014906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTDPVTAMPSTKMSKQWTLSEVLGQRRVLGVGILLAWLLLFHLLVNVWLLCIFTSLLVAL
GGWLGSRAVLDANSLLHLEHFLPLGKVSPPLCSPEHEWRLNHEIHNAVHKAVRDFVSSWY
RTLLPEAEGEFECAVRGSMLESVMELKERARRVDRKALVQQLLQLYGCHLQSYMTARQIQ
STERSFSLWKLYSEVDAPHPAVKSPSEELRYSRALVNLFLHVLVPYPQMETRTGGYMVTE
LITCNVLVPLIQRVSDPDWLNQTILDIITRSREPREVSVNDPPGDPLYMRQNQRESWTTC
RSQSSLPDGISSESTADLDDVQSWSSGCSGDSSQCSLMAAGKPEHCKVNCCSASSHLLRS
KMVLLDSLIPSDSSDGLTGGLCDCGPSANFCNLNLNDEENFGCFGPLKNLGPKAVAPMDP
QCAAGVVSEKFTTSPSRKPCVTANNFDASAHQASPVRIQNVHVSGAVTAMEQRGSSTHPY
TLYVITFEMVAEAENGGPVQRVCYHTVDRRYSEFLNLQTRLEEKPEVKKLIKNVKGPKKM
FPDLMFGNADNDKVEARKTQLDTFLQQLSSIPEMSNSEDMQEFLALNSDATRYFGRKPFA
KSRIDKMMENAFDTLKTAFPNPDLFSPLEELETDGRTADSRKYSAQNRRSIFPSKISPAL
NIPDLHPKVVYCFSEGCTVLSSMTVSDLERFVEQQERRLCEPNGKKAARQSCDQSSKEKK
EAGKTQGTDTAVADVALNILCLLMKDQWSWLCTENIQKTIRLLFGTFIERWLEVGVAHLT
SAPCWVIYLQVLQEAVWPGGALPVQPRPERSAAQRQEAKEQCLDCLMQLLPGTEIVTDML
GSEKFRLSIETMLESLQDPQINKHLIFCICDLLLEFL
Download sequence
Identical sequences H3D2G8
ENSTNIP00000014706 99883.ENSTNIP00000014706 ENSTNIP00000014706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]