SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014781 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014781
Domain Number 1 Region: 94-203
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-38
Family Second domain of FERM 0.00000145
Further Details:      
 
Domain Number 2 Region: 505-592
Classification Level Classification E-value
Superfamily Moesin tail domain 2.62e-33
Family Moesin tail domain 0.0000163
Further Details:      
 
Domain Number 3 Region: 204-351
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-28
Family Third domain of FERM 0.00000254
Further Details:      
 
Domain Number 4 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-23
Family First domain of FERM 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014781   Gene: ENSTNIG00000011827   Transcript: ENSTNIT00000014982
Sequence length 592
Comment pep:known_by_projection chromosome:TETRAODON8:7:6470087:6473346:-1 gene:ENSTNIG00000011827 transcript:ENSTNIT00000014982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPNPSVFQISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYQDTKGFS
TWLKLNKKVVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDATQRLFFLQVKEAILNDDI
YCPPETAVLLASYAVQAKYGDYNKEVHSPGYLSSEQLLPQRVLDQHKLNKDQWEERIQVW
HEEHKSMIREESMMEYLKIAQDLEMYGVNYFNIKNKKGTELWLGVDALGLNIYEQNDKMT
PKIGFPWSEIRNISFNDKKFVIKPIDKKAPGLLCFYATQGLAPSNKPHPWLSGMGHTHEL
GTMAPARKPDTIEVQQMKAQAREEKNQKKMERALLENEKRKRELAEKEKEKIEREKEELI
ERLKQIEEQTKKAQHAELEEQTRRAEELELERVRAQKDAEQLETELRGAEEARMALLQQS
ENQMKNQEHLATELADLTSKISLLEDAKKRKEEEAVEWQQKATTMQEDLEKTKEELKNKV
MVAHIQEPLNAENEHDENDESSAEASAEFGAAVTYNDRSEEERMTEAEKNERLQKHLLVL
SSELANARDESKKTANDILHAENVRAGRDKYKTLRQIRSGNTKQRIDEFECM
Download sequence
Identical sequences H3D2P3
ENSTNIP00000014781 99883.ENSTNIP00000014781 ENSTNIP00000014781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]