SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014824 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014824
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-30
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 376-430
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000155
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014824   Gene: ENSTNIG00000011867   Transcript: ENSTNIT00000015025
Sequence length 447
Comment pep:known_by_projection chromosome:TETRAODON8:2:2169191:2171942:1 gene:ENSTNIG00000011867 transcript:ENSTNIT00000015025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDRYHRAARDGYLDVLKEATRKELNAPDEDGMTPTLWAAYHGNLEALRLIVGRGGDPDK
CDIWGNTPLHLAAANGHHNCLSFLVAFGANVWCLDNDYHTPLDMAATKGHMECVRYLDSI
AAKQITLNPKLVSKLKDRAFRAAERRIKECAKLQKKHHERMERRFLKESAALDNFDAISF
SSYTSGSTLSRKFNTVTSNMPYSQATLQSTAKGKAKLQKKLEKKKQTDGTFKIYEDGRKS
VRSLSGLQHGDHEEDALSRAMSDPGLHDAAYSEISVDSGRDSLFTRPGLGTMVFRRNYMT
RDAFGAAAREEGSVAGSEPVGRTPNVRLRGRLPRRSPSLDEDSIGSALSLQERNAQELPW
EDVDIGLDEDLEPENSPLETFLACQGLSEFMQIFRREKIDLQALQLCSDKDLASIHIPLG
PRKKLLEACKTRLDTLQEPEAIEDTEL
Download sequence
Identical sequences H3D2T6
99883.ENSTNIP00000014824 ENSTNIP00000014824 ENSTNIP00000014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]