SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014874 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014874
Domain Number 1 Region: 175-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000129
Family Ankyrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014874   Gene: ENSTNIG00000011915   Transcript: ENSTNIT00000015075
Sequence length 236
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:93529426:93538842:-1 gene:ENSTNIG00000011915 transcript:ENSTNIT00000015075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHPQQAPLYGRCIVTVQLTEEEVAADDGDVDYFLSFVGSTQRHLTSTLRSSHDTLEAL
CPAHDCCEVVLVTLCSFSPALPKAHEDRRSCLGHVHPLAEHRFSFVQDLAFDMAQFLVST
AGRSDGLEGALLLNECGIPLEECERLDESLALALQHLVLPPEWSLMGRKVNENTDLHPQE
TLLHFAARRGLCQVTRFLLQQSGAREALRLANREGHTPSAVAALGGHRRLQRLLHK
Download sequence
Identical sequences H3D2Y6
99883.ENSTNIP00000014874 ENSTNIP00000014874 ENSTNIP00000014874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]