SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014875 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014875
Domain Number 1 Region: 62-287,336-384
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.15e-46
Family LacY-like proton/sugar symporter 0.025
Further Details:      
 
Domain Number 2 Region: 502-643
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.67e-18
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 
Domain Number 3 Region: 407-486
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000863
Family Pentapeptide repeats 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014875   Gene: ENSTNIG00000011916   Transcript: ENSTNIT00000015076
Sequence length 648
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:93555733:93561019:1 gene:ENSTNIG00000011916 transcript:ENSTNIT00000015076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDEDAASDATEGADEDNQMYEGEYQGIPHPDEIKEARRAARIEARRKARMAAHLAEQYET
IMEDCGHGRFQWMLFFVLGLALMADGVDGFVVGFVMPSAEKDMCISNSDKGLLGLLVYVA
MMVGALVWGGLCDKMGRRKCLIYVLTIDLLFSFLSCFAQGYGFFLFFRFCSGFGIGGAIP
IVYTYFTEFLQMDKRGEHLSWLCMFWMLGGLYASFTAWGIIPHYGWGFAIGTEFQMHSWR
LFILVCLLPALAALVGVVFMPESPRFLLENARHDEAWMILRQVHDTNWKAKGEPERVFTV
THINTPKTQEDEFIEIQSDTGTAFQRWSVRHMTMLQQQVMANVMSLSAPDLRLQGLFLVI
VWFCLAFSYHGLGVWFPDMIKYMQFEEYESKVRTFHRERVERFHFNFSLVNQIHREGEYI
HDKFASIEMKSVKFENSLFENCYFEDIKSTNTFFENCTIKNTIFYNTDLWQEKFKNCQME
NTTFLHPKKGCHLNFEEENDIVIYMVSFLGSLAVLPGNIISALFMDKIGRIRIIGASMLV
SSACTFLLLLSFSQGAVICWQCLFYGASVAAWNGLEVISVELYPSSRRGTAFGILNGICK
FAAIIASFVFAAFIGITKIIPIFLAFAALVCGGLVALKLPETREKILS
Download sequence
Identical sequences H3D2Y7
99883.ENSTNIP00000014875 ENSTNIP00000014875 ENSTNIP00000014875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]