SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014880 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014880
Domain Number 1 Region: 966-1260
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.000000000286
Further Details:      
 
Domain Number 2 Region: 329-492
Classification Level Classification E-value
Superfamily L domain-like 2.58e-45
Family L domain 0.00000332
Further Details:      
 
Domain Number 3 Region: 35-196
Classification Level Classification E-value
Superfamily L domain-like 1.11e-41
Family L domain 0.00000135
Further Details:      
 
Domain Number 4 Region: 488-606
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-29
Family Fibronectin type III 0.0000354
Further Details:      
 
Domain Number 5 Region: 778-922
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-19
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 6 Region: 608-686,788-810
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 174-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000236
Family Growth factor receptor domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014880   Gene: ENSTNIG00000011921   Transcript: ENSTNIT00000015081
Sequence length 1401
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:93596128:93607634:1 gene:ENSTNIG00000011921 transcript:ENSTNIT00000015081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPTERSRLTLFWALMLALPPASGPPPQRVICGPGIDIGNDISEFRRLENCTVVEGYLQ
ILLIGDKNNNVNQETFRSLSFPRLTMITDYLLLFRVSGLDSLSTLFPNLTVIRGRNLFYN
YALVIFEMTSLKDIGLYSLRNITRGAIRIEKNPELCYLDSVDWSVIMDAEFNNYIAGNKQ
SKECSDVCPGVMESSPQCRKTVFNNNYSYRCWNSNHCQRECPDKCGRRACTADGQCCHPQ
CLGSCTRAGSDAACAACVHYYHHGRCVAQCPPGTYRFEGWRCVSVDFCSKVHLPDPHTFV
LHGQECMPECPSGYTRSTTDNMSCTACDGLCDKVCEGEEKVIDSVDAAQSLKGCTVIKGN
LHINIRRGPNNMVAELESFTGLIQRVKGYVRIRHSHTLNSLAFLRSLRYIDGETLLDDMY
AFFAFDNHQLQYLWDWSQHNLTIRTGKLYFRANPKLCVSEIHKMWEKTGIQGRFDESDFR
NNGDRASCESTILAFTSNSTSSTRIKLTWQRYRPPDYRDLISFIVYFKEAPHSNITEYEG
QDGCGSNSWTMVDVELRPDWDADPGVLLSLRPWTQYAVFVKAITLMVENKHMPSAKSKVV
YIRTRPSAPSMPQDVRAYSNSSTQLVVRWSPARPNGNQTYYLVRWQQQAEDKEYQHNYCS
KELKIPIRIAARGVGDQEEDTKPTKPDAEGPQKGPCCPCPKSAEDLEAEAADASYRKVFE
NFLHNSIFTPRPPDRRRRDVFGAANSSHLRYSSAVPPLQADANSSSGAEPLDRDFDFSEQ
SVTERELQISGLKPFTVYRIDIHACNRQVQRCSAAEFVFSRTKPAEKADDIPGLLTWEGH
EDWGFLRWPEPRHPNGLVLMYEVKFQLASESEKHECVSGQSYRTQRGVRLSNLGPGNYSV
RVRAISLAGNGSWTHILDLYVAERYQNILFAMIFVPLAVVLLICLVVTALVVLNKKRNSD
RLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKISLSRELGQGSFGMVYEGLAKGVVKDE
AETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRG
DLKSYLRSLRPEEQQCSSLSLPPLKKMLQMAGQIADGMAYLNANKFVHRDLAARNCMVAE
DFTVKIGADFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWE
VATLAEQPYQGLSNEQVLRFVMEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEIIS
SVKDELEPSFREVSFFYSADNKSSRRAAATLGRSWTTWTSDLLDTPSSSPCVQPPQTAVR
PQTPPPPGSDAPASSPSSPCAAAAGADKQPSSQQAANGLLGAGPGSEGSARSSLDDLPPY
AHMNGGRKNERAMPLPQSSAC
Download sequence
Identical sequences H3D2Z2
ENSTNIP00000014880 99883.ENSTNIP00000014880 ENSTNIP00000014880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]