SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014911 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014911
Domain Number 1 Region: 584-707
Classification Level Classification E-value
Superfamily PH domain-like 0.000000821
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014911
Domain Number - Region: 956-1033
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00249
Family beta-lactamase inhibitor protein-II, BLIP-II 0.063
Further Details:      
 
Domain Number - Region: 188-349
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0418
Family beta-lactamase inhibitor protein-II, BLIP-II 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014911   Gene: ENSTNIG00000011951   Transcript: ENSTNIT00000015113
Sequence length 1147
Comment pep:known_by_projection chromosome:TETRAODON8:3:9239290:9246101:-1 gene:ENSTNIG00000011951 transcript:ENSTNIT00000015113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITLLWAVDVYGRVYSLSTAGQQWVRADDMLLELKRVSAGKGRCWGIGCDHHVYLNIMP
SETSIRYREETYENQRWNPVDGFTDALLPTDRWPWSDVTGLNPQPLHSFELPARSWEWEG
DWYVDQCCGGEPSEGGGWEYAVDFPANFSPEKKWNSCVRRRWIRYRRYTAQGTWAKIPLD
NPRKAPLPLCDISCGGWEMSDQSGKYPYLWGVSQQGQVWFREGIHPRVPEGSGWEEVETP
KEVAQLSAGPGDLLWAVLWDGNLLVRTGLSLDCPTGSSWVEVESPGTRVEALHVAVGVGV
VWVLTKDYKVWFRRGVNSHNPCGSGWISIGGEMLMVDVGLNDQVWAVGEDRGLYFRMGVT
PSEPSGNGWIPVSAQSGCTIRGHVTEAAPAALQRCSDSDSEAGPTGTRGGENAAPVLEAA
SPSVVPLAAPPPAVGSDAPKPFIPASDSFINSLVSDRGKPPNAEEPPPAPVLPTPDPAGH
DVPWMNVDLEGAEAARGAAASYALGTLETSPVAGESDGPVWTWISGGGCEVDADSQIGWL
SPAGPLSSSLSLTPVQSAAWSEQPQQPPPQQKREEISRKPLERSNSVWVRRGALRWWRDW
RPQRWVDVGVALEESTGSDGRKDSIFFVYYTQYDEKKYLQVFLSEVTALVPLLREGHFAF
AVYTPERTKQRWPLILAALGEQDTDDWLSLLSDCCCQLRGIAGPPSRQALWSTTSKGDIM
VHEPSFTLESPAHTHACDLMFWRQVPGHLRWVESNSLGLVWGVGWDGTAWVYSGQPPPAS
VCSAAGAAPVLQQTDVRSVHVYENQRWNPLTGYTDKGLPTDRPMWSDESGLQECTKGSTH
PPSPQWSWVSEWAVDFGVPGGTDKEGWQYAADFPVAFHGHKTMKDFVRRRRWTRQCRITL
RGPWQQVPPLRLSDISLMPCLAQSSMEQVPLWAISEKGDVLCRLGVNPQNPAGGSWLHVG
TDQPFKAISIGGANQVWAIARDGAVFYRGSVSQQNPAGECWYHIPAPPRQTLRQLSVGRT
SVFAVDDNGNLWYRQGLAPSYPQGSSWELISNNVAKVSVGPLDQVWIVAESVAGFPSEAP
GAICHRLGVGPMQPRGQSWDCGIGGGWEHISVRGNSVEAPRARHPPAASPRSPLPPQPVD
CYSPTCC
Download sequence
Identical sequences H3D323
ENSTNIP00000014911 ENSTNIP00000014911 99883.ENSTNIP00000014911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]