SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014913 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014913
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.34e-81
Family IMD domain 0.000000493
Further Details:      
 
Domain Number 2 Region: 329-393
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000263
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014913   Gene: ENSTNIG00000011953   Transcript: ENSTNIT00000015115
Sequence length 488
Comment pep:known_by_projection chromosome:TETRAODON8:3:9251686:9266494:-1 gene:ENSTNIG00000011953 transcript:ENSTNIT00000015115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTVEEVSKLTESTYKSVMEQFNPGLRNLVNLGKNYEKSVTAMTLAAKLYFDAMSKIGE
SAAESPVSKELGAALMEISEVHRKVHLELEENLKRFHREIIAELERKTDMDVKYMTATFK
RYQMEHKMKQDSLEKSQSDLKKLRRKSQGKNANKYENKESECLETLVSRQMDMQLFLADG
CKEALLEEKRRFCFLVDKHCMFSYQTASFHDKARDLLMAKLSSWQDQCTDATDMPDGVLT
MIEGLRTAVPVTPLPSPSPSRHRMSRTQTISAPPVPPLKAQTSPLVNLFNQDNKGYTAAT
THSISKDHQAVEENSLARSVSVATGLNNIVKKPRVRTIFPHTAGNNNTLLSFDEGDVIIL
LIPEEKDGWMYGEMEKNGKRGWFPSSYCRALTDPLVNNSVSSAPYRSRSVVNLHHQDTET
DEATMVLPPADYCDDRPAQQPQEQHQRPANQANGVSRPPPAYLAGGGNPFATVRLRPTVT
NDRSAPII
Download sequence
Identical sequences H3D325
ENSTNIP00000014913 99883.ENSTNIP00000014913 ENSTNIP00000014913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]