SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014947 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014947
Domain Number 1 Region: 20-345
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.55e-57
Family Ankyrin repeat 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014947   Gene: ENSTNIG00000011987   Transcript: ENSTNIT00000015149
Sequence length 864
Comment pep:known_by_projection chromosome:TETRAODON8:9:1291087:1312017:-1 gene:ENSTNIG00000011987 transcript:ENSTNIT00000015149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGGGQDAARARQGDLQTLRELLTAKTLTGDVKDALGATPVHHAARAGKLTCLRFLVEEAG
LSGNCVANNGASPAHDAAATGNLACLQWLLTQGGCRPEHKDSSGATVLHLASRFSHHQIT
DWLLKSGEGDPGASTDTGALPIHYAAAKGDLCSLRLLLEHSPNLINSQTKNGATPLYLAC
QEGHLEIVQYLLKDCQADSSIRANDGMTALHAAAQMGHNTVIVWLMSFTEISLTDRDGDG
ATAMHFAASRGHAKVLSWLLLHGGEIVTDSWGGTPLHDAAENGELECCQILVVNGVDLGI
KDQDGFTAADLAEYNGHSQCAKYLRTVENMSVEHRILSRDPSTDLEYKQPDSGLSSPNTT
MPPASLAAQFDINSPSSSMSNYDSANSSQSSTGEKRPSNVDSASAADMQAYMDMLNPDIG
SDVQKKNSAPSASNPPPPPTYPPPPPPPGSLPTPPPPPSYPAPQPPAEPTSAEFLKVKSN
LRHVESNSKKKKLAPGEGHDRLRRVDSNRKSRSFSKQPSTGDYYKNLSNDSAEPRGSRAM
APNEEVNASMYAGCGSASSEDVGSKHPPSFPPEGSLLLEERSNSPAHTAANGTMEETAAP
PPPPPPPPFPASNPTPPPPPPLPADQTPPAGNPTNQRRPSSSSGGSTKSFNMMSPTGDNS
ELLAEIKAGKSLKPTPHSKGYTTVFSSGGPPSSNGSLTSPSESRISSPPPTPSSPPPSAS
PVLTSPTTTSPRSTPTGSGSADVEALVPTHDEQGKAIPEWKRQVMVRKLQVKMQEEEDHR
RKAEAEAARLASMPAWRRDMMKKKLDEERCEREQKRKAEQKAKEAKEIEEKTELERLRTM
GYDETKLAPWQRQIILKKGDMAKQ
Download sequence
Identical sequences H3D359
ENSTNIP00000014947 ENSTNIP00000014947 99883.ENSTNIP00000014947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]