SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014990 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014990
Domain Number 1 Region: 1175-1401
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-37
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-31
Family Cadherin 0.0008
Further Details:      
 
Domain Number 3 Region: 330-434
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 4 Region: 641-752
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.00063
Further Details:      
 
Domain Number 5 Region: 538-640
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 115-223
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 10-113
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-25
Family Cadherin 0.0023
Further Details:      
 
Domain Number 8 Region: 740-855
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 1424-1619
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-23
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 10 Region: 435-536
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 11 Region: 1114-1154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000203
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 848-950
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000257
Family Cadherin 0.0099
Further Details:      
 
Domain Number 13 Region: 2205-2464
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000293
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number 14 Region: 1701-1838,2143-2169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000345
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 1623-1657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014990
Domain Number - Region: 1663-1699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1095-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00752
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 1155-1185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0221
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014990   Gene: ENSTNIG00000012029   Transcript: ENSTNIT00000015192
Sequence length 2976
Comment pep:known_by_projection chromosome:TETRAODON8:9:692077:739205:1 gene:ENSTNIG00000012029 transcript:ENSTNIT00000015192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSRRAANRHPFFPQYNYQVQVAENQPPGTSVILMSASDPDPGDAGRVSYSMAPLMNSRS
SDYFHIHPETGLITTTQTLDREHMDLHYFRVTATDYGSSRLSGTTMVAITVSDRNDHSPI
FEQTEYRETIRENVEEGYPILQLRATDSDSPTNANIRYRFIGDMVAVARAAFEIDPRSGL
ITTRGVVDRELNEHYTLQVEASDQGKEPGPRSATVKVFITVLDENDNVPQFSEKRYVVAV
KENVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIQVVAPLDYEAER
EYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESSPVGSSILHIQ
AIDTDSGDNARLEYKLTGTSSDTPFIINSATGWVTVRSTLDRESVEHYFFGVEARDYGTP
PLSATASVTITVMDVNDNHPEFLQKEYYARLNEDAAVGTSVVTVTAVDRDVNSAVTYQIT
GGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDRTLHDTCQVHINITDANTH
RPVFQSAHYSVSVNEDSPPGSLVVMISATDDDVGENARITYLLEDNIPQFRIDSATGAIT
LQAELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNAPQFLSPRYQGSVSEDA
PPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGILRTVRRLDRESVPFYE
LTAYAVDRGMPPRTPVHIQVTVLDVNDKAPVFPADDFEVLVKENSAVGSVVAQITATDPD
EGANAQIMYQIVEGNIPEIFQMDIFSGELTSLIDLDYETRNEYVIVVQATSAPLVSRATV
RIKLVDQNDNRPTLQDFQIIFNNFVSNRSNSFPSGVIGRIPAHDPDVSDRLYYTIDRGNE
LHLLLLNHTSGEIRLSRKLDNNRPLVAPMLITVTDGIHSISAQCVLRVLIITEDMLGSSV
TVRLQNMSQEHFLSPLLGNFLEGVSAVLSVPVEDVFIFNIQPDLDAAPGRILNVSFSAAL
PGGLFFPSEALEEQLYLNRPRLTSLTQMEVLPFDDNVCLREPCKNYMKCVSVLRFNSSAP
FISSPSILFRPIHPIAGLRCRCPVGFTGDYCETEINLCYSNPCLNGGVCAPREGGFTCIC
RENYTGDRCEFDHRQGGCVPGVCRNGGTCLELSRGGFRCECPEGAYEPPYCAVTARSFPP
KSFAMFRGLRQRFHLTISLTFATLENSGLLFYNGRFNEKHDFIALEIQEGQVVLKYSTGE
SSTQVTPFLPGGVSDGNWHSVHIHYYNKPKRSIGGEAQGPSDEKIAVVRVDDCDAALSLR
FSTQLGNYSCAAQGKQSSSKKSLDLTGPLFLGGVPNGADNFPFSSREFIGCLKDFHIDNK
QLDLAGFIANNGTTAGCSAKTPFCNSNPCQNGGTCRVGWETFLCDCPLGYGGKDCSHVMP
HPHRFLGNSVQWWDLKNEVTISTPWYLGLVFRTRSREGTLLQAQAGQYTSLLFQVVNSQL
VFSVTRGAARPVRLRLDQVLVADGRWHDLQLELRDVRSDRETRYVATLRLDFGIYQGTVI
VGNEIHGLKVKHLHVGGVFGSGKVQNGIRGCIQGVRLGVRPDAPPLRPPTRTVNVEAGCN
VGNYCVSSPCPTHSRCADQWERHTCVCDPGYYGKSCTDACHLNPCENEAQCHRKPSSSHG
YVCDCGDNHFGQYCQHRSDHQCPRGWWGSPTCGPCDCDTDKGFDPNCNKTSGHCHCKEFH
YHPRGSDTCLPCDCYPVGSFSRSCDAETGQCQCRPGVIGRQCNACDNPFAEVTNSGCEVI
YDGCPKTITQGIWWPRTKFLRAAVSCPKGSVGAAIRHCDVERGWLEPELYNCTSPPFVEL
NAALDSLERNETELSTIMEKKLAHQLRDVTEATARLYGNDLHIAERLLSRLLNFETQQSG
FGLTATQDAYFNENLIRACSALLGPGTSGLWRALIQSQNHIQGGGPAELTGLLRQYSQNL
AKNMKLTYLNPVALVAPNLVMNLDRVETQTHVRRRFPRYHTTIFRGQSPWDPYTHIIMPP
HHSQPPASITVSTNQTVEYASARRALPAPEQPITIVILLIYRSLGAALPPKYHTDRRGVR
LPRHPVMNSPVVSISVFNNETFVSGHLDQPVLLEFKLLETANRSKPLCVQWNHSSQHDLG
GCWTVRDCMVVYRNTSHVRCQCQRLGTFGVLMDSSQREQLEGDLETLALVTYSTLCLSML
ALILTVLVLSCLRGLKSNTRSIHSNTAAAMFLSELVFLLGINQTEQQFLCTVVAILLHYF
FMSTFAWMFVEGLHIYRMQTEQRNINYGAMRFYAIGWGVPAIITGLAVGLDPEGYGNPDF
CWISIYDKLLWSFAGPIAIVILMNGGIFMIVAKISCSPSQKETKKLPVIGTIRDAFLLLL
VATSTWLCGLMAVNNSVLAFYYIFNVLCLLQGLCVMLVFTVFNTEFKEAWRVACLGKKTP
GEDPPRPPQNAAQNPYHNASLLEQSGLHRITLGTSTVSSVSSASIKTTLTPSLESGRDSP
RLTVLQIRENLLARQTLEQNLVHTGATDLDVAMFHRDPGEDSDSDSDLSMEEERSLSIPS
SESEDNVRLRGRIQRRFKRSNHGERLLTEPKDLDGNDLLSYWPALEEGEMNTMQKWGSER
PLGGDYSKDAANNNQTDAALTSGDENNLTQPHKHRKGILKNRLGCPPALQALSSKGRAPS
ELNWYRTSTLGHRGVPAASYGRMYSATAAAGGGSGSLSQPASRYSSREHLDSLTRRQLSR
DPLGRQTIGGSRDRLDSRGSRDNLDLLPRSGSRSQLNALGRRQASSREHLGGVLISSRSR
EQLDTNGGGAQAPPCREWLRSLPPRQPSLPDQPLSSCASPPPPISEEPQQEQLPGSGQAR
GRLDSGPPCRYPAQAVPQAPGSNPLARQPSSEHLDILSSILASFNSTVLTPPAVSGPGPN
GSPAALPPPPPPQSTTSHSISEVSPDSEANRSEGQS
Download sequence
Identical sequences H3D3A2
ENSTNIP00000014990 99883.ENSTNIP00000014990 ENSTNIP00000014990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]