SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015038 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015038
Domain Number 1 Region: 127-391
Classification Level Classification E-value
Superfamily vWA-like 1.67e-89
Family Trunk domain of Sec23/24 0.000000595
Further Details:      
 
Domain Number 2 Region: 8-66,407-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.14e-62
Family beta-sandwich domain of Sec23/24 0.00036
Further Details:      
 
Domain Number 3 Region: 621-762
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.75e-55
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000583
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.32e-45
Family Helical domain of Sec23/24 0.0000103
Further Details:      
 
Domain Number 5 Region: 49-122
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.89e-18
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015038   Gene: ENSTNIG00000012074   Transcript: ENSTNIT00000015240
Sequence length 766
Comment pep:known_by_projection chromosome:TETRAODON8:18:5664842:5670764:-1 gene:ENSTNIG00000012074 transcript:ENSTNIT00000015240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYQEFIQQNEDRDGVRFSWNMWPSSRLEATRLVVPVSCLFTPIKERPDLPPLQYEPVM
CTRATCKVLNPLCQVDFRAKIWACNFCFQRNSFPPSYAGISEVNQPAELMPQFSTIEYVV
QRGPPTPLIFLYVVDTCLEEEDLQALRESLQMSLSLLPPHALVGLITFGRMVQVHELSCE
GVAKSFVFRGTKDLNSKQIQEMLGLAKPTAPGQGRPPAPHDAIVPCRFLQPVHKVDMNLT
DLLGELQRDPWPVPQGKRPLRSTGVALSVAVGLLEGAFPNTGARVMLFIGGPPTQGPGMV
VGDELKTPIRSWHDIQKDNARHLKKATKYYEALANRLADNGHSIDMYACALDQTGLLEMK
CLPNLTGGHIVMGDSFNTSLFKQTFQRVFHKDYNGDLRMFGGTLEVKTSRELKVCGAIGP
CVSLNSKGTCVSENEMGIGGTSQWKICSLNPSTTLGLYFEVVNQHNAPIPQGGRGVIQFV
TQYQHSNTQRRIRVTTIARNTSWADAQSQIQHIESSFDQEAAAVLMARLGVFRAESEEGP
DVMRWLDRQLIRLCQKFGQFSKDDPSSFRLSESLCLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFVRQDLTQSLIMVQPILYSYSFYGPPEPVLLDSGSILPDRILLMDTFFQLVIYH
GETIAQWRKAGYQEMAEYENFKQLLQAPLDDAQEILQARFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNLYGWGQQEAGAPILTDDVSLQVFMDHLKKLAVSSSA
Download sequence
Identical sequences H3D3F0
ENSTNIP00000015038 ENSTNIP00000015038 99883.ENSTNIP00000015038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]