SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015056 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015056
Domain Number 1 Region: 384-571
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.81e-58
Family DNA polymerase beta-like 0.000000233
Further Details:      
 
Domain Number 2 Region: 234-326
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 6.41e-28
Family DNA polymerase beta, N-terminal domain-like 0.000019
Further Details:      
 
Domain Number 3 Region: 329-382
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 5.89e-18
Family DNA polymerase beta-like, second domain 0.00019
Further Details:      
 
Domain Number 4 Region: 41-133
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000291
Family DNA topoisomerase II binding protein 1, TopBP1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015056   Gene: ENSTNIG00000012091   Transcript: ENSTNIT00000015258
Sequence length 572
Comment pep:known_by_projection chromosome:TETRAODON8:18:5958644:5961361:-1 gene:ENSTNIG00000012091 transcript:ENSTNIT00000015258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPHRGILKAFPKVKRAKVSHGKDAPPAKKKPDEFDVTGNTFAGVTAYILPAGIGTARHQ
IFQRQIKQNGGQTESALRPGVTHVVVDDNMDVDRALRLLKVQNVPAGVHLVKCTWLSLCI
SEKKLLDVDGYTLLSPTRSVTWSCMEPKTRHEDAPCEEPAAENTAETASDKLDQVIQEKP
TNGTEPESKAVQGEEDLVSQNELEALMSGQHPKEEAGVSDHGLGPGAAVLNVVPGKWVCA
QSSQSKSSNFNKHITDKLEVLAKAYTHQGDKWRALSYSKAVNALKSYHKPVTSYQEACQI
PGIGKSMADKIDEIMESGHLRKLDHIGEAVPVLELFSNIWGAGAKTAQLWYQQGFRTLED
IRTKAHLSSTQKIGLKHYEDFLDRMPRGEAAAIEKVVKDAALAVDPHLVAMACGSYRRGK
ATCGDVDVLISHPDGKSHRGVFTKVLQSLHDSGFLTDDLVSHEENGEQKKYMGVCRLPGP
GHRHRRLDIIVVPYNELACALMYFTGSAHFNRSMRALAKTKSMSLSEHSLNENVVREGSV
KVFGGAPLATPTERDVFNLLGIPYRQPHERDW
Download sequence
Identical sequences H3D3G8
99883.ENSTNIP00000015056 ENSTNIP00000015056 ENSTNIP00000015056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]