SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015134 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015134
Domain Number 1 Region: 77-185
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-24
Family Cadherin 0.00036
Further Details:      
 
Domain Number 2 Region: 297-419
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-23
Family Cadherin 0.007
Further Details:      
 
Domain Number 3 Region: 186-301
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-22
Family Cadherin 0.00063
Further Details:      
 
Domain Number 4 Region: 406-510
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000999
Family Cadherin 0.007
Further Details:      
 
Domain Number 5 Region: 5-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000871
Family Cadherin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015134   Gene: ENSTNIG00000012170   Transcript: ENSTNIT00000015338
Sequence length 564
Comment pep:novel chromosome:TETRAODON8:1:17478632:17493726:-1 gene:ENSTNIG00000012170 transcript:ENSTNIT00000015338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHSDSDRGDGSVRYVLTGDGAGTIFKIDEKSGDIHATKRLDREEKAYYILYAKAINRFT
NAALEGQSEFIIKIHDINDNEPKFTRDPYTAQVPEMSDIGTSVIQVTATDADDATYGNSA
RVVYSILEGQPYFSVDPETGLVKTALPGMDREVKENYQVVIQAKDMAGQMGGLSGTTTVS
ITLSDVNDNPPRFTKTLYEFRVPESLEPGSVVGVVRALDADIGENAQMDYRIIGSDGPGV
FEIAANRSTQDGVIVLRKPLDFEKKQQFGLRLQVENVHINPRFFSMGPFRDEASVKITVE
DVDELPVFERPSYIMEVKEDAPKNTVLGSVSASDPDDKRSPIRYTIDWRTDMDRVFNVHA
GNGSVYVLRQLDREDNAWHNISVMATEFNNPQQVSRVPVYVRVLDVNDNAPAFATNYETF
VCENAKANQRIQTISATDPDEPLAGHRFFFSLAQEAAGKANFSVRDNKDNTAWILTRRNG
YSSLQSVPVVISDGDFPMQSSTNTLTIRVCSCDREGNMKLCNAEALTARAGLSTGALVAI
LLCVLILLIAAWIWSTQRAHQHQP
Download sequence
Identical sequences H3D3P6
ENSTNIP00000015134 99883.ENSTNIP00000015134 ENSTNIP00000015134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]