SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015143 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015143
Domain Number 1 Region: 366-489
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-26
Family Cadherin 0.005
Further Details:      
 
Domain Number 2 Region: 148-256
Classification Level Classification E-value
Superfamily Cadherin-like 7.01e-25
Family Cadherin 0.00026
Further Details:      
 
Domain Number 3 Region: 257-371
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-19
Family Cadherin 0.00095
Further Details:      
 
Domain Number 4 Region: 475-580
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 79-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000128
Family Cadherin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015143   Gene: ENSTNIG00000012179   Transcript: ENSTNIT00000015347
Sequence length 780
Comment pep:novel chromosome:TETRAODON8:1:17937110:17951492:1 gene:ENSTNIG00000012179 transcript:ENSTNIT00000015347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDTMTTNQILFLLVLSILWPSSAMPFTPGNIGNLFGMEDDGRILQRSKRGWMWNQFFLLE
EYTGNDHQYVGKLHSNMDKGDGSVRYVLTGDGAGTLFLIDEKSGDIHATKRLDREEKAMY
TLNAKVLDRNTNAELEPDTEFNIKIHDINDNAPKFVKEIYFASVPEMSDVGTTVVTITAT
DADDQTYGNSAKLVYSILQGQPYFSVDSENGTIKTALPGMDREVKEHYQVVIQAKDMAGQ
MGGLSGTTTVSITLSDVNDSPPRFANHSFRVTTPESTEVGGAIGRIKADDPDVGRNAEME
YSIVGGHDIFNIITDQKTQEGVIVIKKTLDYETKKDYEFRVEVKNTYLDARFIHGLQFKD
YATVRVTVEDVDEPPVFTRNPYIIEVHEDTAAGSFVGVVSARDLDADKKAVKYSIDRHTD
LERLFNIDSTNGTITTLKALDREMSKWHNISVVATEINNPGQTTRVPVFIKVLDVNDNAP
EFAMSYDTFVCENVKAGQLIQTISAVDTDEPLVGHKFIFTISPTNPNFTIVDREDNTANI
LTRRGGFSRREMSMYFLPVVISDNDYPIQSSTSTLIVRVCACDSHGNMQSCSPEVLPFSD
GLTTGALVAILLCVIILLMIVVLFAALRRQRKKEPLIISKEDVRDNVVSYNDEGGGEEDT
QAFDIGTLRNPEVMDANKLRRDIIPEMLFPFRRTSPIKDNTDVRDFINGRLQENDSDPTP
PYDSLATYAYEGSGSLAESLSSLESTATEGDHDYDYLSNWGPQFKKLAEMYIGKSPDRET
Download sequence
Identical sequences H3D3Q5
99883.ENSTNIP00000015143 ENSTNIP00000015143 ENSTNIP00000015143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]