SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015145 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015145
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-25
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 379-484
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-24
Family Cadherin 0.0028
Further Details:      
 
Domain Number 3 Region: 263-377
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 484-588
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 83-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000101
Family Cadherin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015145   Gene: ENSTNIG00000012181   Transcript: ENSTNIT00000015349
Sequence length 801
Comment pep:known_by_projection chromosome:TETRAODON8:1:18350045:18424129:1 gene:ENSTNIG00000012181 transcript:ENSTNIT00000015349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRISTNSCLCPFLVCLCFIQRCSGVSHHSPAKVPSKNQTKLANGETEVHHRPKRGWIWNQ
FFVLEEHMGPDPQYVGKLHSNSDKGDGSVRYILDGEGAGTIFIIDEVTGDIHATKSLDRE
KKSHYVLHAQALDRYTEEALEPKSEFIIKVQDINDNAPKFPDGPFVATVPEMSEVGTSVL
QVTASDADDPTYGNSARIVYSILQGQPYFSVDPKTGIIRTALADMDREAREHYTVVIQAK
DMAGQVGGLSGSTTINITLTDINDNPPKFPQKNYQLYVPESAQVGKPVGKIKANDEDLGI
NADIKYSIINSEGANTFAISADRDTKEGIISLKKPLNYERKKTYTLHIEGMNTHADPRFS
YLGSFKDTATLKITVGDVDEGPVFSIDHYIMDVYENAPSGTEVGTVTARDPDSRNSPVRY
FLDSKEDDERYFRVDEISGTIRTTQPLDREDTIWHNITVMASEVALDNPSLLSHVPVTVQ
VLDVNDNPPEVAADEEVIVCESSRPGQVIQTVTAVDKDDFANGQRFTFALPSQLPVNPNF
TLKDNEDSTASIIARRRRNHLTQELYELPIVVWDGGEPSLSGTSTLTLRGCPCQRHGRNP
ICHSSRFNNNTGTHVGSSGIAILLCIVILLAIVVLFITLRRSKKEPLIISEEDILRAMVV
YHDDEGGGEDGRPLTIIALLQPRPQSEVSSSSDVDIRLEAGRYNTAVWPAAHRSPSVDSG
VYVDVQVFIKQRLVDAKMDTSTTPYRSWARHEGQGSPRGSIRQLDSPRMQSEQDYNFLDE
YGPEFQRLAELYGHGDSDVTT
Download sequence
Identical sequences H3D3Q7
ENSTNIP00000015145 99883.ENSTNIP00000015145 ENSTNIP00000015145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]