SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015175 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015175
Domain Number 1 Region: 957-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-106
Family Thrombospondin C-terminal domain 0.00000000325
Further Details:      
 
Domain Number 2 Region: 834-955
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.27e-36
Family TSP type-3 repeat 0.000000302
Further Details:      
 
Domain Number 3 Region: 29-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-35
Family Laminin G-like module 0.000000427
Further Details:      
 
Domain Number 4 Region: 753-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.58e-17
Family TSP type-3 repeat 0.0000877
Further Details:      
 
Domain Number 5 Region: 490-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.02e-16
Family TSP-1 type 1 repeat 0.0000855
Further Details:      
 
Domain Number 6 Region: 434-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000589
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 7 Region: 314-371
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family VWC domain 0.0039
Further Details:      
 
Domain Number 8 Region: 379-427
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 9 Region: 690-750
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000012
Family TSP type-3 repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015175
Domain Number - Region: 546-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015175   Gene: ENSTNIG00000012209   Transcript: ENSTNIT00000015379
Sequence length 1172
Comment pep:known_by_projection chromosome:TETRAODON8:14:2286502:2294449:1 gene:ENSTNIG00000012209 transcript:ENSTNIT00000015379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKLTGIFLLLILWTCESTRVAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYK
ILDPDLIPAVPDQAFSDLIDSIRAERGFLLLLNFKQFKRTRGSLLTVEKKDGSGPVFEII
SNGKANTLDIVFSTENKQQVVSIEEVDLATSQWKNITFVQEDQAQLYVGCEDVNTAELDA
PIQSILTQETPAGARLRIGKGAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQNSISSETM
ILENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLFSMFKELKSLGVVVKELSNELRQLTD
ENKLIKNHIGIHNGVCIHNGIMHKNKEEWKVDDCTECTCQNSATVCRKISCPVISCANAT
IPDRECCPHCGTPRDSAEDSWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTR
DCYIQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQFGGKSCTGEGRQT
EKCQKSSCPINGNWGPWSPWDTCTLTCGGGVQIRKRLCNDPEPKYGGKDCVGDAKDIQIC
NNKSCPIDGCLSNPCFAGVKCTSFPDGSWKCGKCPVGYSGNGIKCKDIDECKEVPDACFE
FNGVHRCENTDPGYNCLPCPPRYSGPQPYGKGVEQAVAKKQICTPRNPCLDGSHECNKNA
RCNYLGHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNLDLICVENATYHCKKDNCPNL
PNSGQEDYDNDGIGDACDNDDDNDGIPDDRQKQDNCPFVYNPRQYDYDRDDVGDRCDNCP
YNSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPL
EHNPDQVDTDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQLDSDGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFR
KFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGNTAGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVVMYEGKKIMADSGSI
YDKTYAGGRLGLFVFSQEMVYFSDLKYECRGK
Download sequence
Identical sequences H3D3T7
ENSTNIP00000015175 ENSTNIP00000015175 99883.ENSTNIP00000015175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]