SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015180 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015180
Domain Number 1 Region: 218-398
Classification Level Classification E-value
Superfamily MIR domain 1.44e-44
Family MIR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1076-1167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.33e-18
Family SPRY domain 0.08
Further Details:      
 
Domain Number 3 Region: 657-792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000038
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3899-3958
Classification Level Classification E-value
Superfamily EF-hand 0.0000000618
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 5 Region: 434-545
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000615
Family IP3 receptor type 1 binding core, domain 2 0.011
Further Details:      
 
Domain Number 6 Region: 2041-2117
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000262
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.00000889
Family MIR domain 0.027
Further Details:      
 
Domain Number 8 Region: 1320-1449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000277
Family Peptidase A4 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015180   Gene: ENSTNIG00000012216   Transcript: ENSTNIT00000015384
Sequence length 4821
Comment pep:known_by_projection chromosome:TETRAODON8:14:2349336:2427905:-1 gene:ENSTNIG00000012216 transcript:ENSTNIT00000015384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVATIQKEHRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DLCICNFVLEQSLSVRALQEMLANTGQNSEGAGQGGGHRTLLYGHAILLRHSFSNMYLTC
LKTSRSLTDKLSFDVGLQEHSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSTERYL
HLSISNSSTQVDASFMQTLWNIQPTCSSGNMAVGYLIGGHVMRLCHGHDESLTIPGAESS
EEMQRIVNYEAGKGASKARSLWRLEPLRISWSSSHIRWGQAFRLRHLSTGHYLALSEDRG
LVLQDREKSNTAATAFCFRPSKDAEEKSDLGAKRDIDGMGVPEIKYGDTVCFIMHVETGL
WLSYLAPDAKSSRLGPLKRRACLHSEGHMDDGLILQRCQHEESRAARIIRNTTFLFTNFI
NIAEGGTAEVASFVEDVLQTLNDLIEYFKQPDSELEHEQKQCLLRSLIKRQDLFKEEGML
TLLSRCIDQLNLYNSAAHFAEKAGEEAGAAWKDVLNLLYELLAALIRGNRTNCTQFSHKL
DWLVSKLERLESSSGILEVLHCILVESPEALNIIQRAHIESIISLLYKHGRNHKILDVLC
SLCVCNGVAVRANQNLICDTLLPERDLLLQTRLVNDVQSMRPNIFLGVAEGSAQYKKWYF
ELVIDQVDHFVTGESTHLRVGWANTRGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLWSG
RIPRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTDGFFFPVVSFS
AGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMHIEAVKDYKRDHEGVRDLLGTTQ
FLSQSSFIPTPVDTSQVVLPPHLDDVRNKLAENIHELWGMNKIELGWTYGKIRDDNKRQH
PCLVDFSKLPETERNYNLQMSSETLKTLLALGCHVAQVNIHAEDDLKKIKLPKDYMMSNG
YKPAPLDLSDVKLSAGQEVLVDKLAENAHNVWKDRIKQGWTYGIQQDLKSRRNPRLVPYA
LLDERTKKSNRDSLREAIRTLIGYGYDIDPPDQEAGAHVVLNETIETTRLFRVEQTYAVK
TGKWYFEFEAITGGDMRVGWARPGCRPDVELGADDQVFVFDGYRGRRMHTGGRYFGHPWK
KGDVVGCMINMEDKSMIFTLNGELLITNKGSELCFTDFETEDGFIPVCSLGMSQIGRMNL
GKDANTFKYYTMCGLQEGFEPFAVNMNREITMWFSKRLPTFVNTPQDHAHIEVTRIDGTV
DSPPCLKVTHKTFGTQNSNNDMLYCRLSMPVEFYSADMLLDESPKFRSQIYDKHLKMLPS
LPFVSPQYYHSVRVFAGQDPASVWVGWVTPDYHYYSKNFNLSKTRTVTVTLGDERGRVHE
SVQRSNCYMVCAGDAVNPSSSGRSNSDLEIGCLIDLATGLVTFTANGKELSTVYQVEPNT
KLFPAVFVRPTSADLFQFEFVKMKDVMPLSSAIFKSELRNPVPQCPPRLDVQTIVAVLWS
RMPNTFLSVETARVSERHGWVVQCLEPLQIMAVHIPEENRCLDILELSEHEDLRKFHYHT
LMLYCALCALGNTRVAHLCSHLDQSQLLYTIDNQYLSGMLREGFYSVLIRLRLILQQEAR
LMMNNEFIIPVTDETRSIKLFPDESKRHSLPGVDLSTSLKPRVNFSPVGVINRSRQQYLH
SPQIPLGILKEKAISMLTEAVQGGGTHIRDPVGGSVQYQFVPILKLIGTLLIMGVLTSEE
VRIILLMIDPNVFGEVKEGEEAKEEEAGPAGKPSAAKGLLEKLLPEPVKRQMCELLQYFC
DCELKHRIESIVSFSDSFVSKLQFNQKFRYNELMVALNMSAAVTAKKTKEFRSPPQEQIN
ILLNFSAGEDCPCPEEIQEELNSFHEELRLHCGIPIEEEEEDQDTSIKGRLLALLYKIKG
PPQKIEKEPEKEQAAPTNLKELISQTITSWAQESHIQDPELVRVMFSLLRRQYDGIGELL
RAMKKTYTISAASVQDAINLLASLGQIRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHP
NLMRVLGMHETVMEVMVNVLGGDKSQQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHL
SYLLENSSVGLAASEAMRGSTPLDVAASSVMDNNGLALALEEPDLEKVVTYLAGCGLQSC
AMLVAKGYPDLGWNPIEGERYLSFLRFAVFCNGESVEENANVVVKLLIRRPECFGPALRG
EGGQGLLVAMKEAIKISEDPTLDLPKILEGVSAGSGEEGGEVIHMGNAIMSFYSALIDLL
GRCAPEMHLINAGKGEALRIRAILRSLVPTFDLVGIISIPPKMPVVNKDGSVTEPDMSAC
FCPDHKAPMVLFLERVYGIEDQNFLMHMLEVGFLPDLRAAASLDTETLSTTETALALNRY
IGSAVLPLLARCSALFAGTEHYTQLIDSTLQTIYRLCKGRSLTKAQRDAIEECLLAICKH
LRPTMMQQLLRRLVFDVPVLSEYCKIPLRLLTNHYEQNWKYYCLPSGMGSFGTASDEELL
LTKKLFWGIFDSLSHKKYDAELFKMARACLCAIAGALPPDFVDASFGATLEKQASLDAQG
NFDPKPINTANISLPEKLEYITNKYAEHSHDKWSSEKVSAGWKQGDSVNEHTKSHPLLKP
YKALTEKERETYRWPVRESLKSMLAMGWNIERSKEGEAVFQQRESDKQKKTSDPQQINGF
SPAPMDLHNITLSRELQSMVEMVAENYHNIWAKKKKTELISRGGGTHPLLVPYDTLTAKE
KYRDREKAQELFKFLQINGYVITSDRGLKDMEQDSSSMEKRFSYKFLKRLLQYVDSAQEF
IAHLEAMATSGKTDKSPHDQEIKFFAKVLLPLTDQTFKNHCLYFLSTPSKNLSSCGCASN
KEKEMVTSLFCKLAALVRHRISLFGSDSAIMVSCLDILTHSLDTRTVMKSGSELVKAGFR
AFFENAAEDLEKLVEMLKLGKFMQSRAQMKSVSQSINYVTVALLPILTALFDHIKTHEFG
IDLLLDDVQLSCYRILTCFYSLGTGKNIFVERHLPALGESLATLVGAIPVAFLEPDLNAY
NSLSVFNTKTPRERAILSMPDTVEEMCPEIPRLDKLLRDVNDVSESGARYSDMPQVIEVI
LPMLCNYLSYWWEKGPENSPPGAHCCTMVTSEHLSIILGNILRILNSNLGIDEAPWMKRI
AVYSQPIICKAGADLLRSHFLPTLVKLKKKTEKVVAEEELLKADSKGDNQEAELLILDEF
AVLCRDLYAFYPMLIRYVDNNRSRWLKEPDADSTELFRMVAEIFILWCKSHNFKREEQNF
VVQNEINNLGFLTGEAKSKMSKSGGDQERKHKRRRGEYYSIPTSLIIAALKKMLPIGLNM
CTPGDQELISLAKKRYSLKDTDDEVKEHLRQNLHLQDKSEDPAVQWQLNLYKDVVVKCEE
PVNPEHTVSRVQSISAALFHLDLVEAPLRNKKCVCQKLLSKQRKRAVVACFRMAPLYNLP
RYKNNNYFLNGYREVWLERAFKASSFDRLFSLLTKTPMKIVEEEEEEVAEIQPDPLHQLI
LHFSHNALTERSHLEEDPLYIAYADMMAKTCKTLFRKKTFEEKEMEKQKILYQQARLHAR
GAAEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVQVQQKMLDYLKEKRDAGFFKSLS
GLMQSCSSVLDLNAFERQNKAEGLGMVTEEGSSSKVLQNDEFTKDLFRFLQLLCEGHNGD
FQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKEVIDDTGKVNFSKALSVA
KQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDASQIELLKELMD
LQKDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSNNVEMILKFFDMFLKLKDLTTSDNFK
EYDPECKGVISKKEFQKSMESQKQYSQSEIEFLLSCAEADENDMFNYKEFVERFHEPAKD
IGFNVAVLLTNLSEHMPHDSRLATFLDLAESVLSYFEPYLGRIEIMGSAKRIERVYFEIS
ESSREQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMQLASKISEPDAGE
QPEEEEEDGYSILGELAGEEDDALESASAFAAACCSVKRKLGTARQFFSIKNLRKQLKKI
KKLSIKEIVTGFFSFFWMLFIGFFKGIYSIVFGFFHIIWSSMFGGGLVEGAKNMKVTDIL
GNMPDPTQFGIHGDVVEGEKAEALESPGSLDITIAPAGDIAEVDVMLELLTCPKKEGGKH
AEPGLGDVSELSAETSATEQKKVGHRNLREWLVWMYRHLFFFKKNPLFQKSMKTEETPES
EAEKADKTRSSHQKEEATSLTSGVFALLDVYLTKMLNYLARNFYNLRFLALFVCFAINFI
LLFYKVAGEDTDDENRWGGDAEDDEDTFFDMDEFVLQESTGYMLPTLRFLAVFHTIISLL
CLVGYYCLKVPVVVFKREKEIARQIEFDGLYITEQPSDDDIKGQWDRLVINTPSFPNNYW
DKFIKRKVINKYGDLYGAERIAELLGLDKSALDFDPTVETVEKEASLVSWLSSIDTKYHT
WKLGVVLTDNNFLYLIWYTTMSIFGHFNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQL
VLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYMFHMYVGVRAGGGI
GDELEDPAGDPYELYRILFDITFFFFVIVILLAIIQGRSDPSTPSATLRDQQEQVKEDME
TKCFICGIGNDYFDTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQE
RCWDFFPTGDCFRKQYEDQLG
Download sequence
Identical sequences H3D3U2
ENSTNIP00000015180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]