SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015182 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015182
Domain Number 1 Region: 230-407
Classification Level Classification E-value
Superfamily MIR domain 5.62e-45
Family MIR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1089-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-18
Family SPRY domain 0.08
Further Details:      
 
Domain Number 3 Region: 670-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000388
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3967-4026
Classification Level Classification E-value
Superfamily EF-hand 0.0000000633
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 5 Region: 448-558
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000745
Family IP3 receptor type 1 binding core, domain 2 0.011
Further Details:      
 
Domain Number 6 Region: 113-195
Classification Level Classification E-value
Superfamily MIR domain 0.00000379
Family MIR domain 0.027
Further Details:      
 
Domain Number 7 Region: 2091-2166
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000929
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015182
Domain Number - Region: 1381-1501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000211
Family SPRY domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015182   Gene: ENSTNIG00000012216   Transcript: ENSTNIT00000015386
Sequence length 4895
Comment pep:known_by_projection chromosome:TETRAODON8:14:2349336:2427905:-1 gene:ENSTNIG00000012216 transcript:ENSTNIT00000015386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVATIQKEHRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DLCICNFVLEQSLSVRALQEMLANTGQNSEGSADHEKWLLKAKAGQGGGHRTLLYGHAIL
LRHSFSNMYLTCLKTSRSLTDKLSFDVGLQEHSTGEACWWTIHPASKQRSEGEKVRIGDD
LILVSVSTERYLHLSISNSSTQVDASFMQTLWNIQPTCSSGNMAVGYLIGGHVMRLCHGH
DESLTIPGAESSEEMQRIVNYEAGKGASKARSLWRLEPLRISWSSSHIRWGQAFRLRHLS
TGHYLALSEDRGLVLQDREKSNTAATAFCFRPSKEKSDLGAKRDIDGMGVPEIKYGDTVC
FIMHVETGLWLSYLAPDAKSSRLGPLKRRACLHSEGHMDDGLILQRCQHEESRAARIIRN
TTFLFTNFIKALDSIAEGGTAEVASFVEDVLQTLNDLIEYFKQPDSELEHEQKQCLLRSL
IKRQDLFKEEGMLTLLSRCIDQLNLYNSAAHFAEKAGEEAGAAWKDVLNLLYELLAALIR
GNRTNCTQFSHKLDWLVSKLERLESSSGILEVLHCILVESPEALNIIQRAHIESIISLLY
KHGRNHKILDVLCSLCVCNGVAVRANQNLICDTLLPERDLLLQTRLVNDVQSMRPNIFLG
VAEGSAQYKKWYFELVIDQVDHFVTGESTHLRVGWANTRGYAPYPGGGEGWGGNGVGDDL
YSYSFDGLHLWSGRIPRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDF
NTDGFFFPVVSFSAGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMHIEAVKDYKR
DHEGVRDLLGTTQFLSQSSFIPTPVDTSQVVLPPHLDDVRNKLAENIHELWGMNKIELGW
TYGKIRDDNKRQHPCLVDFSKLPETERNYNLQMSSETLKTLLALGCHVAQVNIHAEDDLK
KIKLPKDYMMSNGYKPAPLDLSDVKLSAGQEVLVDKLAENAHNVWKDRIKQGWTYGIQQD
LKSRRNPRLVPYALLDERTKKSNRDSLREAIRTLIGYGYDIDPPDQEAGAHVVLNETIET
TRLFRVEQTYAVKTGKWYFEFEAITGGDMRVGWARPGCRPDVELGADDQVFVFDGYRGRR
MHTGGRYFGHPWKKGDVVGCMINMEDKSMIFTLNGELLITNKGSELCFTDFETEDGFIPV
CSLGMSQIGRMNLGKDANTFKYYTMCGLQEGFEPFAVNMNREITMWFSKRLPTFVNTPQD
HAHIEVTRIDGTVDSPPCLKVTHKTFGTQNSNNDMLYCRLSMPVEFYSADMLLDESPKFR
ALVLLHFSPHQMFSLHCFCCFYSRPPKDDGSADYGSITTVTRQRSQIYDKHLKMLPSLPY
YHSVRVFAGQDPASVWVGWVTPDYHYYSKNFNLSKTRTVTVTLGDERGRVHESVQRSNCY
MVCAGDAVNPSSSGRSNSDLEIGCLIDLATGLVTFTANGKELSTVYQVEPNTKLFPAVFV
RPTSADLFQFEFVKMKDVMPLSSAIFKSELRNPVPQCPPRLDVQTIVAVLWSRMPNTFLS
VETARVSERHGWVVQCLEPLQIMAVHIPEENRCLDILELSEHEDLRKFHYHTLMLYCALC
ALGNTRVAHLCSHLDQSQLLYTIDNQYLSGMLREGFYSVLIRLRLILQQEARLMMNNEFI
IPVTDETRSIKLFPDESKRHSLPGVDLSTSLKPRVNFSPVGVINRSRQQYLHSPQIPLGI
LKEKAISMLTEAVQGGGTHIRDPVGGSVQYQFVPILKLIGTLLIMGVLTSEEVRIILLMI
DPNVFGEVKEGEEAKEEEAGPAPSAAKGLLEKLLPEPVKRQMCELLQYFCDCELKHRIES
IVSFSDSFVSKLQFNQKFRYNELMVALNMSAAVTAKKTKEFRSPPQEQINILLNFSAGED
CPCPEEIQEELNSFHEELRLHCGIPIEEEEEDQDTSIKGRLLALLYKIKGPPQKIEKEPE
KEQAAPTNLKELISQTITSWAQESHIQDPELVRVMFSLLRRQYDGIGELLRAMKKTYTIS
AASVQDAINLLASLGQIRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHPNLMRVLGMHE
TVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGL
AASEAMRGSTPLDVAASSVMDNNGLALALEEPDLEKVVTYLAGCGLQSCAMLVAKGYPDL
GWNPIEGERYLSFLRFAVFCNGESVEENANVVVKLLIRRPECFGPALRGEGGQGLLVAMK
EAIKISEDPTLDLPKILEGVSAGSGEEGGEVIHMGNAIMSFYSALIDLLGRCAPEMHLIN
AGKGEALRIRAILRSLVPTFDLVGIISIPPKMPVVNKDGSVTEPDMSACFCPDHKAPMVL
FLERVYGIEDQNFLMHMLEVGFLPDLRAAASLDTETLSTTETALALNRYIGSAVLPLLAR
CSALFAGTEHYTQLIDSTLQTIYRLCKGRSLTKAQRDAIEECLLAICKHLRPTMMQQLLR
RLVFDVPVLSEYCKIPLRLLTNHYEQNWKYYCLPSGMGSFGTASDEELLLTKKLFWGIFD
SLSHKKYDAELFKMARACLCAIAGALPPDFVDASFGATLEKQASLDAQGNFDPKPINTAN
ISLPEKLEYITNKYAEHSHDKWSSEKVSAGWKQGDSVNEHTKSHPLLKPYKALTEKERET
YRWPVRESLKSMLAMGWNIERSKEGEAVFQQRESDKQKKTSDPQLQINGFSPAPMDLHNI
TLSRELQSMVEMVAENYHNIWAKKKKTELISRGGGTHPLLVPYDTLTAKEKYRDREKAQE
LFKFLQINGYVITSDRGLKDMEQDSSSMEKRFSYKFLKRLLQYVDSAQEFIAHLEAMATS
GKTDKSPHDQEIKFFAKVLLPLTDQTFKNHCLYFLSTPSKNLSSCGCASNKEKEMVTSLF
CKLAALVRHRISLFGSDSAIMVSCLDILTHSLDTRTVMKSGSELVKAGFRAFFENAAEDL
EKLVEMLKLGKFMQSRAQMKSVSQSINYVTVALLPILTALFDHIKTHEFGIDLLLDDVQL
SCYRILTCFYSLGTGKNIFVERHLPALGESLATLVGAIPVAFLEPDLNAYNSLSVFNTKT
PRERAILSMPDTVEEMCPEIPRLDKLLRDVNDVSESGARYSDMPQVIEVILPMLCNYLSY
WWEKGPENSPPGAHCCTMVTSEHLSIILGNILRILNSNLGIDEAPWMKRIAVYSQPIICK
AGADLLRSHFLPTLVKLKKKTEKVVAEEELLKADSKGDNQEAELLILDEFAVLCRDLYAF
YPMLIRYVDNNRSRWLKEPDADSTELFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLG
FLTGEAKSKMSKSGGDQERKHKRRRGEYYSIPTSLIIAALKKMLPIGLNMCTPGDQELIS
LAKKRYSLKDTDDEVKEHLRQNLHLQDKSEDPAVQWQLNLYKDVVVKCEEPVNPEHTVSR
VQSISAALFHLDLVGNRQKNEHVEAPLRNKKCVCQKLLSKQRKRAVVACFRMAPLYNLPR
HRAINFFTPAYQRLWIEAEEYSFEEKLVQDLAKTPMKIVEEEEEEVAEIQPDPLHQLILH
FSHNALTERSHLEEDPLYIAYADMMAKTCKTLFRKMIFFCSPRAVKTFEEKEMEKQKILY
QQARLHARGAAEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVQVQQKMLDYLKEKRD
AGFFKSLSGLMQSCSSVLDLNAFERQNKAEGLGMVTEEGSSSKVLQNDEFTKDLFRFLQL
LCEGHNGDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKEVIDDTGKVN
FSKALSVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDASQI
ELLKELMDLQKDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSNNVEMILKFFDMFLKLKD
LTTSDNFKEYDPECKGVISKKEFQKSMESQKQYSQSEIEFLLSCAEADENDMFNYKEFVE
RFHEPAKDIGFNVAVLLTNLSEHMPHDSRLATFLDLAESVLSYFEPYLGRIEIMGSAKRI
ERVYFEISESSREQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMQLASK
ISEPDAGEQPEEEEEDGYSILGELAGEEDDALESASAFAAACCSVKRKLGTARQFFSIKN
LRKQLKKIKKLSIKEIVTGFFSFFWMLFIGFFKGIYSIVFGFFHIIWSSMFGGGLVEGAK
NMKVTDILGNMPDPTQFGIHGDVVEGEKAEALESPGSLDITIAPAGDIAEVDVMLELLTC
PKKEGGKHAEPGLGDVSELSAETSATEQKKVGHRNLREWLVWMYRHLFFFKKNPLFQKSM
KTEETPESEAEKADKTRSSHQKEEATSLTSGVFALLDVYLTKMLNYLARNFYNLRFLALF
VCFAINFILLFYKVTPFSPVAGEDTDDENRWGGDAEDDEDTFFDMDEFVLQESTGYMLPT
LRFLAVFHTIISLLCLVGYYCLKVPVVVFKREKEIARQIEFDGLYITEQPSDDDIKGQWD
RLVINTPSFPNNYWDKFIKRKVINKYGDLYGAERIAELLGLDKSALDFDPTVETVEKEAS
LVSWLSSIDTKYHTWKLGVVLTDNNFLYLIWYTTMSIFGHFNNFFFAAHLLDIAMGFKTL
RTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCY
MFHMYVGVRAGGGIGDELEDPAGDPYELYRILFDITFFFFVIVILLAIIQGRSDPSTPSA
TLRDQQEQVKEDMETKCFICGIGNDYFDTPHGFETHTLQEHNLANYLFFLMYLINKDETE
HTGQESYVWKMYQERCWDFFPTGDCFRKQYEDQLG
Download sequence
Identical sequences H3D3U4
99883.ENSTNIP00000015182 ENSTNIP00000006881 ENSTNIP00000015182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]