SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015248 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015248
Domain Number 1 Region: 24-147
Classification Level Classification E-value
Superfamily PX domain 5.49e-31
Family PX domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015248   Gene: ENSTNIG00000012281   Transcript: ENSTNIT00000015452
Sequence length 161
Comment pep:known_by_projection chromosome:TETRAODON8:14:3621986:3629835:1 gene:ENSTNIG00000012281 transcript:ENSTNIT00000015452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNTIADTRRLFTKPQNLNDAYGPPSNFLEIDVCNPETVGVGRNRYTTYEVKLKTNLPIF
KLKESCVQRRYSDFEWLRAEERESKVVVPPLPGKALLRQFPFRGDDGIFDENFIEERRQG
LEQFLNKVAGHPLAQNERCLHMFLQDKVLDKNYTPSKIRQA
Download sequence
Identical sequences H3D410
ENSTNIP00000015248 ENSTNIP00000015248 99883.ENSTNIP00000015248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]