SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015291 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015291
Domain Number 1 Region: 22-138
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-24
Family SH2 domain 0.00057
Further Details:      
 
Domain Number 2 Region: 390-565
Classification Level Classification E-value
Superfamily Ras GEF 9.15e-21
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015291   Gene: ENSTNIG00000012323   Transcript: ENSTNIT00000015496
Sequence length 694
Comment pep:known_by_projection chromosome:TETRAODON8:1:22695628:22700464:-1 gene:ENSTNIG00000012323 transcript:ENSTNIT00000015496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFSRDQFILECSSEKLRKELEEELKMDCEELRSHAWYHGAIPRQVAENLVQRDGDFLIRD
SLSSPGSYVLTSQWRNTAQHFKINKKVVALNEAYTRVEFRLEREGFDSVPALIRFYVGNR
KPVSQVVGAIIFQPINRAVPLRCLEERYGLSNNHRERLMTQERRSQKRLSLNISNGHAHD
GGHAGRMKDRCGSQPASLNQVHDRRRPLKAHQSESYLPLGSKPQAPPPADSLPLSPTHKS
PVFRTGSEPVLSPSLPRRSAELLSGHPMRGSDGQLCPKPPPKPSKVLLSRLSPPSDSARL
AAPPPDPPCGERRVGSSPAGAPPPDGAFDLQPPRCSHAERLRREELGEGEAGGRSSYRHA
IASSGSSSEEEQREEGRKLVETESTFRPADFGSRLLPAENKPLEVAVLRRAKELLLSHDH
RSIARHLLQADCRVARILGVSPQLRAQMGVASGLELVTLPHGHQLRLDLMERHHTMAIGV
AVDILGCTGSVEERATTLNRIILVAVELKDAVGDLFAFTALMKALDLPHITISRLEETWT
TLRRNYTQTAISYEKTLKPFFKNLYEGTASPPPTVCVPVLLPLLTLMERSSTSPEGAELW
ETNDQGCDILLHLEAARGVAHNAQSYRENAENVLDGFGCDEELLEVLKTDFQLRLLWGSR
GASVNQSDRYNKFNLILTALSRKLEPPPKIQTVI
Download sequence
Identical sequences H3D453
ENSTNIP00000015291 99883.ENSTNIP00000015291 ENSTNIP00000015291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]