SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015323 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015323
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000302
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015323   Gene: ENSTNIG00000012355   Transcript: ENSTNIT00000015528
Sequence length 195
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14821397:14822270:1 gene:ENSTNIG00000012355 transcript:ENSTNIT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMMGIARSSVVCFVIDTTGSMSDDIAEARKVVHDIIDSKKGTQDEPSEYILVPFNDPGFG
PMIRTTDPEKMKKEINALRPAGGGDIPEMCLSGLQLALTGAPASSNIYVFTDAPAKDTYL
KDTIVALIRSTKSTVSFFLTGSSRRRRRSLTASSIGDYEDLALASGGQTIRVSKAQLPQA
TDIILDTSTSALVRL
Download sequence
Identical sequences H3D485
ENSTNIP00000015323 99883.ENSTNIP00000015323 ENSTNIP00000015323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]