SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015340 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015340
Domain Number 1 Region: 221-345
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.00088
Further Details:      
 
Domain Number 2 Region: 434-557
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 3 Region: 118-225
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.0054
Further Details:      
 
Domain Number 4 Region: 334-438
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-23
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 550-660
Classification Level Classification E-value
Superfamily Cadherin-like 5e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 20-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000328
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015340   Gene: ENSTNIG00000012372   Transcript: ENSTNIT00000015545
Sequence length 976
Comment pep:novel chromosome:TETRAODON8:Un_random:15170949:15185883:1 gene:ENSTNIG00000012372 transcript:ENSTNIT00000015545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEEMIWLILLISILDGAVSQLHYSVPEEQEPGSVVGNIAEDLGLDITKLSARRFQTVPS
SRTPYLEVNLENGALVVKEKIDREEICKQTIPCLLHLEVFLENPLELFRVEIEVMDINDN
APSFPETDISVEISESAIPGTRFPVENAFDPDVGTNALSTYAITNNNYFYLDVQTQSDGN
KFAELVLEKSLDREQQALHRYVLTAVDGGIPQRTGTALLVVKVLDSNDNAPTFDQTVYSV
SLRENSPVGTLVIQLNATDVDEGQNGEIVYSFSSHNAPRIKDLFNIDARTGRIEVAGEVD
YEESNTHQIYVQAKDLGANAVPAHCKVLVKLTDVNDNTPEIGFSTVTESVSEQDAPGTVI
ALFSVSDRDSGENGHMSCEILGDVPFKLKSSFKNYYTIVTDGPLDRENTDSYTITVVAKD
KGQPSLATSKSIKVHVSDENDNAPRFTQAVYDVYVTENNVPGAFIHAVSALDPDMGQNAL
ITYSILECDIQGMSVDTYVSINQDTGYLYALRSFDYEQLKEFSFMVQAKDSGASELFSNS
TVNVIIVDQNDNAPTLIAPIGKNGTAREHLPRSAEPGYLVSRIVAMDADDGENARLSYSI
LRGNEMGMFRMDWRTGELRTARRISAKRDPQGYYDLLIEVRDHGQPPLSSSASVSVILVD
SVVEGRSGDRGPASRAKETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKDKKLNLYTC
LLAGDCCLCCSSCCSRQARGRKQKKLSKSDIMLVQSTNVTSGVGPVGQVPVEESGVGGVG
GGFGSHHHQNQNSYCYQQKKHAHHHHSVELMAPQPLYSLYNILPLLSMLDDFRASPSSAF
QEADIVSSKDSGHGDSEQGDSDHDATNRGHSAGRIAAEGFSRLLFLENNECDLKMQIHCT
EECKALGHSDRCWMPSFVPSDGRQGPDYRSNLHVPGMDATLPDTEVPSSVNLSDQLTMTS
STASSNDRSFSTFGKD
Download sequence
Identical sequences H3D4A2
99883.ENSTNIP00000015340 ENSTNIP00000015340 ENSTNIP00000015340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]