SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015341 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015341
Domain Number 1 Region: 447-576
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 233-340
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 124-231
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-22
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 340-451
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-18
Family Cadherin 0.0071
Further Details:      
 
Domain Number 5 Region: 563-670
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-16
Family Cadherin 0.005
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015341
Domain Number - Region: 52-130
Classification Level Classification E-value
Superfamily Cadherin-like 0.000286
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015341   Gene: ENSTNIG00000012373   Transcript: ENSTNIT00000015546
Sequence length 1120
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:15392756:15399112:-1 gene:ENSTNIG00000012373 transcript:ENSTNIT00000015546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKVLAVFATAAAMAPGVTGKTLKYQTFEEQKVGTVIARLKDDVADVLAKPRSSVSLRFK
AVQRGSSSFLSVREQDGEISVRTKIDREKLCEKNLNCSIQFDVLTLPTEHLQLFHVDVEV
LDINDNAPQFARAVIPIEISESAAVGARIPLDSATDPDVGENSLYTYALEPNNFFKIDIQ
SRTDGAKYAELVVLRELDREMRATYELQYTASDRGVPPRTGSTLLKISIVDSNDNSPVFE
KSSYVINLPENSPVGTLLIDLNATDADEGTNAKIVYSFSSHVSPKIMETFKINPDTGHLT
LIRRVDYETINSFDIDVQAQDMGPNSMPAHCKILVTVVDVNDNKPDISINPMSSQGNGDA
AYISEASPLDNFVALVRVEDLDSGLNGEVDCKLHSQGYFKLHKSNENNYMILTNMSLDRE
KKSEFSLTVVAEDRGTPSLSTVKHFTVHITDENDNPPRFEKGRYEVFKSENNAPGAYLTS
VMATDPDLETNGQVSYSILENSVHGNSISTYVTIDPSNGAIYALRTFDREDVSCITFVVQ
AKDAGKPPMSSNVTVILNILDENDNPPVIVVPQLWNFTADVPASKFTEAGQLVTMVRATD
RDTGVNAELICSIVSGNEESFFIIDPRTCEIHANASLENYPHEHAELTVMVRDQGRESLS
AKAVLKITLYENMENHVQVMDQGESTVDAPLIIIISLVAICAVLLVIMVVFAAHSSRERK
DARNSYNCRVAESTHQHHPKKPSRQIHKGDITLVPTVNGTLPIRAHHHSPTATPPLDRAQ
MGSRPNHNSRQSLNSLVTISSNHIPESFALELAHATPPVEQVSQLLSMLHQGQYQPRPSF
RGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDCDMGRESPVDRLLLGEGFSDLIHLE
MHHRLHPAMRLCTDECRILGHSDQCWMPPISSPASSADYRNNMYIPGEESSQQPQTDDDQ
SSVDSERRKSFSTFGKECGSEEGGGAGSLLTEMNSVFQRLLPPNMDSYAECNETSPTSST
ADNRRVMLPGGKSPAYPPGVAAWAASTHYLNPGTNGQSSHLKWLPAMEEIPENYEEDDFE
GVFHQGHPGGKRSEVSHEAGMDSSELVHEINKLLQDVRQN
Download sequence
Identical sequences H3D4A3
ENSTNIP00000015341 ENSTNIP00000015341 99883.ENSTNIP00000015341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]