SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015351 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015351
Domain Number 1 Region: 447-577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000148
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 2 Region: 638-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000479
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 676-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 383-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000264
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 744-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000011
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 6 Region: 347-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 306-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 864-920
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000023
Family VWC domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015351
Domain Number - Region: 604-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 715-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00252
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 422-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00722
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015351   Gene: ENSTNIG00000012383   Transcript: ENSTNIT00000015556
Sequence length 1257
Comment pep:known_by_projection chromosome:TETRAODON8:10:12986908:13002213:1 gene:ENSTNIG00000012383 transcript:ENSTNIT00000015556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNGQRAPRFPLVCLLLTLQAQVSRSTGYFEVQLISVENTGGRLLSGDCCDAEKRASEGP
CGADECDTYVKVCLKEFQTEVETKGACTYGSGTTKVIGGNTFQFKSGQNSGAHRPSEAGR
ILIPFQFAWPRGFTVIVEAWDRDNDTYGNGDEELLIGRSVYKGMLNPGEEKQTVEQQGAG
ARLAYAVRVRCDQHYYGAKCNKVCRPRDDYFGHYACDPLGNRECLEGWTNLTDSCKVAAE
AVCRQGCSRQHGTCGAPGECRCNYGWQGALCDQCVPYPGCVHGTCGVPWECICEKNWGGL
LCNKDLNYCGTNRPCRNGGTCMNTEPDEYDCACPDGYSGKNCEIAEHACASNPCANGGTC
HEVPSGFECHCPPGWSGPTCAKDTDECASGPCAQGGTCVDMDNGFECICPPQWTGRTCQI
DINECLGKPCLNAYACKNLIGGFYCACFPGWAGQSCDIHVNSCHGQCQNGGSCKDSSGGY
QCICPPGFAGRHCELQRNRCASAPCRNGGRCHALPDGYACDCPPGFAGTACEVQKDPCSP
DPCQNRARCHALQGDFYCSCPDDYEGKTCSDLKDHCRTHRCRVIDSCTVAVAPNGTQKGA
WHISSNVCGPHGRCVSQPGGNFSCWCEPGFAGTYCHENINDCASSPCRNGGTCIDGINAF
QCVCPGGWEGPLCDADVNECSRKPCQNGGACVDLLNDFYCDCVDGWKGRSCHSRVSQCDA
TTCSNGGTCYDHGDAFLCGCPGWGGSTCNTAKNSTCDSGPCTGGTCVGGSDAFTCVCKDG
WEGPTCTQNVDDCNPHPCYNGGLCVDGVNWFRCECAPGFAGPDCRINVDECQSSPCAEGS
TCLDQINGYRCSCPPGHAGARCQEFVGLGKPCHHAGLQFPHGGRWEEECNACRCTDGSVR
CSKVRCGRRPCRLQAPPPPAGAVAASCPGGQECLQHPFLTCFTPPCHQWGVCSAPDPPTP
LNTQCKPNSGYLDNSCARITLIFKKDKVPKGTTVENICSELRYLPVTQTLADDRPLLILC
DLSYANSDAVEVAMSFEEEAPSKESDRGRIQKAASAIISALSKRHNSTVMLAVVEVKVET
QAEPPPIGYLVPVLGVVFGLLWIVCIVVCVLWTRKRKKERERAAPSDDMTVNNQLEPLRG
HAPKDNRHRDVQYECRKLVAAADRKCDGAEGVEEAEPGEELEEDDERGMGLGEKCPPLKC
STARARDRGGARKGGLICTSHSGPVKAPHRTPYSPKDNRCKNLNAARLSEDVKDHYV
Download sequence
Identical sequences H3D4B3
ENSTNIP00000015351 99883.ENSTNIP00000015351 ENSTNIP00000015351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]