SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015361 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015361
Domain Number 1 Region: 50-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-95
Family Protein kinases, catalytic subunit 0.0000113
Further Details:      
 
Domain Number 2 Region: 632-743
Classification Level Classification E-value
Superfamily KA1-like 4.74e-45
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015361
Domain Number - Region: 305-363
Classification Level Classification E-value
Superfamily UBA-like 0.0432
Family UBA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015361   Gene: ENSTNIG00000012393   Transcript: ENSTNIT00000015566
Sequence length 743
Comment pep:known_by_projection chromosome:TETRAODON8:10:12876910:12896525:1 gene:ENSTNIG00000012393 transcript:ENSTNIT00000015566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKTPLPTVNEKVTESHTTHSNGRQEISARSARTGVRSRSSEEPQQPHVGNYRLLKTIG
KGNFAKVKLARHILHGPRAVAIKIIDKTQLNPNSLQKLFREVRIMKILNHPNIVKLFEVI
ETERTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAE
NLLLDADMNIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVI
LYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPSKRGTLEQIM
KDRWINTGFEEDELKPYTEPELDITDQKRIDVMVGMGYNLEEIQDSLAKMKYDEITATYL
LLGRKASELEPSESASSSNLSLTKPRPNSELNGQSPTHIKVQRSVSSSHKQRRYSEQAGQ
NVPPGMAHPKRSQTSTTDSSPKEDGGVQLRKPSTPGSRGAPPSSPLLGNANNPNKADIPE
RRKGVASGPSNNTASAGMTRRNTYVCSDRNNADRLSVIPNGKENSVAVSPSAQRNPVASI
HSIANATTPDRLRFPRGTASRSTFHGGHLRDRRTATYNPPASPTLSHDATPLSQTRSRGT
SNLFSKLTSKLTRRVSTEFERNGRLEGSSRHVPGDQKGETKDGKPRSLRFTWSMRTTSSM
EPCDIMREIRKVLDANNCDYEQQESFLLLCVHGDGHAENLVQWEMEVCKLPRLSLNGVRF
KRISGSSIAFKNIASKVANELKL
Download sequence
Identical sequences H3D4C3
99883.ENSTNIP00000015361 ENSTNIP00000015361 ENSTNIP00000015361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]