SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015388 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015388
Domain Number 1 Region: 358-527
Classification Level Classification E-value
Superfamily vWA-like 6.53e-27
Family Integrin A (or I) domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015388   Gene: ENSTNIG00000012418   Transcript: ENSTNIT00000015593
Sequence length 1248
Comment pep:known_by_projection chromosome:TETRAODON8:9:10254529:10262970:-1 gene:ENSTNIG00000012418 transcript:ENSTNIT00000015593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLINKENRSALPLSVSDITSCVRGYTLAMTASLTYENIEDHAIEGIFIYPLEENSIVV
GFEAMISSQILTLQIKDKSKMEDCLLDCCSSSDGVLQGSSVNAPWPTFAGHILMDEDLER
TVLVVNLGFIPPMETVHVLVSTSSELCTLPSGGISVSSPPACTPRVQRTINEEQGLSPNF
SRTRPSGVFSPHEQTPSSPQLWLSSLLEEETINSMDYEFNFQLEIRAPYLLAGVESPSHA
IRADADPLARSATSVVITLADKYTYDCPVRILIYPSEPHLPHVLVENGDMTLEEYDEYLR
GRGDFIKATKKDSSNERKVDIIRRRLHKDILHHPVVMLNFCPDLKSISSDLRKVHGEFIF
LVDRSGSMSGVNINRVKDAMVVMLKSLMPGCFFNIVGFGSTYKSLFPTSQNYDEEALTLA
CEYIRKIRADMGGTNVLDPLSWMLRQPKIRGHPRLLFLLTDGAVSNTGKVIELVRRHARY
IRCFTFSIGQNACRRLVEALATVSKGTAEFLADGERLQPKMIKSLKKTMSAVLSDICVEW
LFPETEEVLLSPVGNTFLFPGDSLIGYSVVCDTTRYHANPKSDKRRRYSMMRSVESASSV
FYHSQEEDALKMGVDTSASRDDSYQESMTDSSPVSRDADPSGFDCRTSPRRRAYSTNQIN
DYNPAKKVYTPSDPSSVMTKNPLRRTKAQELIGQMGLEHEARWRNDYQPQLASLCATSSS
GFPAGGTGPFSLQELIPQQEFEDSDLRIPPPQETPQSINAPHATRSRDDGSRSSTDSPSV
DSTGSETFLWERMLQLLRVCVSDCYGHQVCQAETPHEVLSKVVVSGLLCGKPAKWEVLFD
IRPYLSGREREEKVHEELWNETFHYLAGRSIIHDFEHMAEKECEIELGLGRKYQLYAVQT
SKACNIQSKYTAFIPVDLDTNEYLPTCVEYINPHDGAKRSSHSSSRSGSRKKRGYSIGLG
RSQSGVRRHIFTELKAENPAETQFNIYGLSDGSNRRYESLPAPNSVSVSMAQVSQRSPSV
TSDQSQKSLESLFSARLALSRTRLLTRAAKGFMCRSHSKSGDSVGESENENKDYIPLVLL
QSASGAFPLDTALCEAINVPMDKLKWTSPFSSHRASLSHVSQSSSRRADASDDGQGAPSE
PEFCQQPAEPAAGIQSPSHLSKSVCCPGKRMLDTESLIWATAVALAWLEHSSASYFIEWE
MIAAKASMWLSAQDIPEGRDLASIKAAANQLFIILRHWDENLQLNMLC
Download sequence
Identical sequences H3D4F0
ENSTNIP00000015388 99883.ENSTNIP00000015388 ENSTNIP00000015388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]