SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015395 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015395
Domain Number 1 Region: 3104-3289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-38
Family Laminin G-like module 0.00081
Further Details:      
 
Domain Number 2 Region: 3370-3591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-35
Family Laminin G-like module 0.00052
Further Details:      
 
Domain Number 3 Region: 1553-1569,2878-3051
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.51e-34
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 316-401
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 2419-2506
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 1864-1919,2087-2125
Classification Level Classification E-value
Superfamily Immunoglobulin 7.29e-19
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 2781-2873
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-18
Family I set domains 0.0096
Further Details:      
 
Domain Number 8 Region: 2703-2791
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 9 Region: 2236-2333
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 10 Region: 2328-2425
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-17
Family I set domains 0.052
Further Details:      
 
Domain Number 11 Region: 1686-1769
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-16
Family I set domains 0.0000948
Further Details:      
 
Domain Number 12 Region: 1444-1579,1961-2001
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.96e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 2506-2593
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000115
Family I set domains 0.0099
Further Details:      
 
Domain Number 14 Region: 2140-2225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000222
Family I set domains 0.026
Further Details:      
 
Domain Number 15 Region: 2610-2701
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000195
Family I set domains 0.023
Further Details:      
 
Domain Number 16 Region: 1777-1862
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000474
Family I set domains 0.041
Further Details:      
 
Domain Number 17 Region: 1591-1674
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000875
Family I set domains 0.017
Further Details:      
 
Domain Number 18 Region: 1068-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000795
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 19 Region: 675-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000014
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 20 Region: 234-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 21 Region: 116-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 192-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 23 Region: 278-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 3312-3356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.009
Further Details:      
 
Domain Number 25 Region: 3048-3089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000364
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 735-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000077
Family EGF-type module 0.079
Further Details:      
 
Domain Number 27 Region: 1126-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 28 Region: 796-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.048
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015395
Domain Number - Region: 635-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000454
Family EGF-type module 0.094
Further Details:      
 
Domain Number - Region: 1032-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015395   Gene: ENSTNIG00000012425   Transcript: ENSTNIT00000015600
Sequence length 3594
Comment pep:known_by_projection chromosome:TETRAODON8:9:10174327:10206451:-1 gene:ENSTNIG00000012425 transcript:ENSTNIT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYYRALVNFTDSLVYGPELEDIYSVAFNEISEAVVDTLQSEYNRIPGTQTVNVVLIKKVV
REDGVDVFVELDVGSDYNSNDEQIRSVLYNVVREGAIASYVTSVQGFQFRRLGEVSPVVR
ACMADEHRCGDGTCILMEYLCDNRPDCRDMSDEANCVCPIMVVESRQSPPPVFTTPPTTT
TPVKKPAVLPRPAGPCRVDQATCQNGECISRDYVCDGERDCSDGSDEFRCGTPSPCEPNE
FKCKNGRCALKLWRCDGDNDCQDNSDETDCPTRGPGDRCAPEQFECLSDRTCIPASYQCD
EEPDCPDRSDEYGCTPPSVTSPPEESVQAARGSTVTFTCQAVGVPMPIITWRLNWGHIPA
SARISMMSENGRGTLTIRDVKESDQGAYTCEAINAKGLVFGIPDGVLTLTSTSNPGNCPE
GHFGVDGRCISCFCAGITKSCKNTGRYRNHISLRFTDEDDFKGVNVTYPSRPGIPPLSST
QLLIDPEMEEFQLVDLSRRFLSLDSFWTLPRQFLGNKAHSYGGSLKYKVRYTLARGSSEV
VERPDVILVGNGRRLVYRRGSPTPARVANQKEIKFTEDNWQHSNGRSVTRQDLMMTLANL
DSISIRTVYDSHMVSAALSDVVMDTTTVEFSILGHAKNVEECRCPPGYYGLSCETCSPGF
ERVSGGSYLGTCAGCNCNGHASACDPVNGHCLSCQHHTEGPRCDKCRSGYFGDPSRGRPD
DCKPCPCPYYETSRRFSNTCFLDVDNQPTCDACRLGYTGRRCEKCASGYQGNPVLPNGKC
VSDQSSTCDNRGVVSSSSRPCSCKNNVAGALCDQCKAGFFHLSAANPDGCLRCFCMGVTK
QCASSTWNREQVRGAVNGQLFSLSNSGNTKTFREGISQTSSSEVVYRSFSSLPRDVYYWV
LPESFRGDKVTAYGGELQYTVRFSPSLPAQMINDQPDVVLQGNGIFLEHYSETRPAPHAS
QSISVTFREAAWRRADGQACTREHLLMALADISVFMIRATYMDNMAESSRITDIRMDIAV
PEAVGSQPALEVEQCACPQGYRGPSCQECDAGYTRASSGLYLGTCERCNCHGHASSCDPE
SGSCLQCLHNTAGPRCERCQPGYYGNPVTGGAQACQPCPCPGTASSNQFSSTCYQDTDGQ
PTCDSCPPGYAGRRCERCGPGYSGNPLLGQRCSQDTVVPLTGDCYPCDQRGSEGCNNGGA
CRCKMNVEGPTCTSCKPGNFHLSSENKDGCLSCFCMGVTQQCFSSTYYRDLVSSVFSPGN
FQGFALVNQQRTTRISTGFTVEVSTEGTQLSYSSFDYLGQEPHYWQLPGAFQGNKVGSYG
GKLQYTISYVAGPRGTVLDDGDVQIIGNDITLVARQPWRRRQQGGRATQKFQLVFREENW
RRPDGMPATREHLMMVLADLDDILIPASYSTEMRSSSISDISMEVAVPNYSGLAQALEVE
QCRCPPGYQGLSCQDCAPGYTRTGGGLYLGHCELCECNGHSDSCHPETGICSSCLHNTQG
ELCEQCAPGFFGDPTVGTPEDCQPCACPHADPDNQFSPTCESLGNGGYQCTACQPGYTGQ
YCERCAPGYVGNPQERVKCRPYDAAASLVVKVFPERVLTPQNSPVTLRCQVYSNPPHYFF
WSREDGRSISGSAERRRQGAELYFPNVQPTDAGVYVCTCRDQRGTNRSRAEIVVTNVQSK
AIEVTVEAPKSQTVRVGSTVSFICTAKSKSPAYTLVWTRMGNGKLPNRAMDFNGILTIQN
VQPEDAGVYVCTGSNMLAMDEGNAVLYVPGAGDGAQPVASVTPPVLNVQQGQRAEFRCTA
TGNPTPAIEWAGGPGSRMSPRAVIRGGVLTFAAVDAADEGEYTCKALNTHGEHVARVSLV
VQMGSQPQVQVSPQNIQVHEGDTLRMYCRATGSPTPRLSWLKNGGLLPAQVSLVHVCASV
ESHDAVEMRMLTISPLFVSSPAIPSHGFHQFKSNSLDVLHRRIEELQVCPSVCLCRLLAV
RHSPCLHSLSTNCSSRCPSGWLTVGGPPVLVVLSSSFGRESKLCPTLTQQRYMGTGVDGG
SPPLSLPSCPTRSGSGLSIGSVGIPDRSAPLQPCDRGLGGLARMDRTDIGTLLIPDVQLS
DSGTYMCVGSNSIGSNSAPVKVTVLKGEVPNTVNTDQSFPAVSIQPSTADIQEGQSLELN
CVAPGNPPPKVSWWRASGLSSNHQVLGNQLRILSATAEDSGEYTCRVEGNHGNPSSGGHQ
ATVSVSVTSSSSRLQSPIIAIEPHSAVVRVGETATFRCRIYSGAQPVRLEWKVANNQHLP
DNVKVSRDGSVITIVNVRPENHGSYRCVASNPFGITHTVVSVIVKDSPVAVVTPAGPVRV
RLGQPINLECQASGEPRPSVSWHRLDSNRTAASDRTSSRLAIAAFNVKILAARPEDSGTY
VCTARSGDSSTETKVEVIVEGKPTASVPEPQMVVVEGRTATLRCHAHGFPAPVITWSKLR
SPLPWRHKVVNSSLVLPSVGRQDSGEYICRASNRMGASQATIKLDVETLPYATLLPDNVA
VRAGEVIRLQCLAHGTPPLTYTWTRLDGRLPSRAVVNGGDLQINLAAADDAGSYKCVASN
SVGSSEVIAKVAVRFSSERLATENVAVFAAPLAVRVSPQVEVRAQGSAVEFTCSAAGGLD
TTIEWLKEGGALPPNHHVKDGVLRIEDLEQSNEGVYICRASSSFGQAQDTARLTIQALPK
VMINVRTSVQTVMIGNSVEFECQALGEPEPTVQWSKVGGSLPAHIMVKGGMLRIEQVTEV
DAGQYRCTATNDVGSVQSQVVLNVQSLPQISALPEKKEVTVGSDAVLPCVASGYPAPEIR
WSKLEGELPSKCLQEVNVLTVPRVAHEDSGTYVCTASNKQGKVEAFTRLQVHERVMPYFA
QEPLSYLTLPTIRNAYKTFNIKVNFRPDNGDEGMILYNGQKRTTGADFISLGLVGGRLEF
RFDVGSGMATIRDPNPVKLGEFHTVELYRNHTLGYIVVDGGEPINGSSQGKFQGLDLNEE
LHVGGYPNYTLLAKTAGIKTGFVGCIRQLVIQGEEVIFKDLHRNSTGVSNCPTCKDRPCQ
NGGACEDSETSLYRCSCPRGFTGSNCQHHSSLHCHSEACGPDATCINRANGLGYDCRCHL
GKFGNKCMEGELVTTPLFDGDQSYIAYPPLTNIHDDLRVELEFKPLERDGLMFFCGGKKM
KVEDFVSISMVEGHVEFRYELGTGQAVLLSLEPVSLGQWHKVVAERNKRAGHLKVDQGPT
QRIFSPGKAQGLNIHTPMYLGGVPNMDLLPKPANISQMFQGCVGEVSINNKKLDLSYSFT
ESRAIRTCVDGSPCDRRPCLNGGHCLSSAEYEYQCLCQDGFEGERCEVLKDVCQSNRQCQ
NGGICVEGLCVCLPAYTGPTCGEGRVPSVSRATWESAASEANDSPYQFEAHFHKDGYISL
PKSVFPRSTPDSPETIELEISTGFPDGLILWQGVELGEHGRGKDFISLGLQNGHLLFSYQ
LGSGEAHILSREAVNDGRWHKVTAVRTGKDGYVQIDGGAAVHGQSRGRSIMVNTKGSVYL
GGAPDMVAMTGGKFSAGLSGCVRNLVLMNGGQPAQTVDLQAHAASGFNVQPCSS
Download sequence
Identical sequences H3D4F7
ENSTNIP00000015395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]