SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015422 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015422
Domain Number 1 Region: 246-289
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000591
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015422   Gene: ENSTNIG00000012452   Transcript: ENSTNIT00000015628
Sequence length 359
Comment pep:novel chromosome:TETRAODON8:9:9967543:9979010:-1 gene:ENSTNIG00000012452 transcript:ENSTNIT00000015628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVSEESLLESFCSGGGGSGRLRNADLLKTFKPFIGHPDPQLRAKYREEFKLNIDRIAV
VKSENGEKYLVLKKKYRQLLQEREARHSRADVDAQGRPSSGTAPWDGTGGTPVSSGRSDT
RALQPIQHAPPSCPVVQVQYAAPSSRDDDLDKDPGSKSESEQDEESTGSVGSAAVALDPI
EKEWIYSAAGARVPDLSQLLRQDPSLANKKDFTSVNGSSLGGQARQQGHGRSGGRRRRRR
QQQIGEGYTPLHIAALHGHQHILDLLMGTYGAKANLRDYSGHLAFYYLKMKEPEGPEDDG
ELPFQATQARDRNRNRKLASLFHSKKKWGSAEELAPIEEERTAPPQLILPAFRPRKFSR
Download sequence
Identical sequences H3D4I4
ENSTNIP00000015422 ENSTNIP00000015422 99883.ENSTNIP00000015422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]