SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015426 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015426
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily Prefoldin 0.000068
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015426   Gene: ENSTNIG00000012456   Transcript: ENSTNIT00000015632
Sequence length 135
Comment pep:known_by_projection chromosome:TETRAODON8:9:9921953:9923967:1 gene:ENSTNIG00000012456 transcript:ENSTNIT00000015632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPKGRVAVEDVHVTYEDQQRINNFATNMRRMTELKNELEAKKKSLQNLQDASDDLMM
LDDDALLVPYQIGEVFISHTQEETQEMLEAAKXLKDDGSMGIELRVSDIQQVLGDLKVHL
YAKFGDNINLEADES
Download sequence
Identical sequences H3D4I8
99883.ENSTNIP00000015426 ENSTNIP00000015426 ENSTNIP00000015426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]