SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015432 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015432
Domain Number 1 Region: 268-443
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.71e-71
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000559
Further Details:      
 
Domain Number 2 Region: 445-545
Classification Level Classification E-value
Superfamily E set domains 2.52e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015432   Gene: ENSTNIG00000012462   Transcript: ENSTNIT00000015638
Sequence length 787
Comment pep:known_by_projection chromosome:TETRAODON8:9:9735425:9745237:-1 gene:ENSTNIG00000012462 transcript:ENSTNIT00000015638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSYLESRRPAGLALSPRIEITPSREHYSHGRDSLQNQPLNISPRPTLTVPGHENLAYREP
QCLSPASSNSSTSWQSESYSPWTSPCVSPSNGQNPGDLCPRLQSIYTSSPRTSPGTSPGT
ATAEDGCLGARSPSPRPGSRSSSPQGKRTYDMYRNPGLAPGHRSRSPSPHRGHEHPGPQY
THGGLADAANGFASAQAGLVPTKIVKTSNHLYNLYPENQAEGNYALSLEQDVKAKPAEPF
FVIPPIWHKPMVSSICSIPVASLPPLEWPIPGRTDQYELSIEVQPKPHHRAHYETEGSRG
AVKAPTGGHPMVQLHGYRGKEPLGLQIFIGTADERILKPHAFYQVHRITGTVTTTSFEKI
VHGTKVLEIPLEPKNNMKAIIDCVGILKLRNADIELRKGETDVGRKNTRVRLVFRVHVPQ
PGGQHVSLQVASHPIECSQRSAHELPMVEKQDMDHCSVLGGQQMILTGQNFSSDSKVVFM
EKSQEGQHTWEMEASVDKDKSQPNMLFVEVPAYRDASVCHAVKVNFCVINGKRKRSQPQH
FTFTPLAVPSIKTEPLDELEAEHMGFVIPQILGLSSHSYYHSQRGVVYPDSSVASCQRLS
SSLPNHDGRFQPQSPAIVYSRGGKSVGGSPGLYQHPGGMMPDPHCSVLVHTGCPAQPVGA
GQHPSIIQFSPTNQQLVRAGEPQAPQQESPQIIYSEGYSPQATLTPSATPPQAQHVQNYP
TVIQQQPFLQKVQEKARSPPGLGQMEAPGDGQRRVTVKEENLDQAYLDDVNEIIRKDLTG
VQARGQT
Download sequence
Identical sequences H3D4J4
99883.ENSTNIP00000015432 ENSTNIP00000015432 ENSTNIP00000015432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]