SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015487 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015487
Domain Number 1 Region: 378-617,646-720
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.54e-55
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 7-121
Classification Level Classification E-value
Superfamily EF-hand 1.4e-41
Family EF-hand modules in multidomain proteins 0.00056
Further Details:      
 
Domain Number 3 Region: 184-259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 95-185
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000119
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 5 Region: 262-327
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015487   Gene: ENSTNIG00000012518   Transcript: ENSTNIT00000015693
Sequence length 730
Comment pep:known_by_projection chromosome:TETRAODON8:9:8814956:8821451:1 gene:ENSTNIG00000012518 transcript:ENSTNIT00000015693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTNPEVKELSPVDFIQLQQYIEYCSVKVKDVLREFDADGSLARHRHGECINEEGFRL
FLKTYLEVEDFPADLCQRLFRSFQNPEAAQEEATKEVFLKDVSCYFSLLEDGQPRDKLEF
AFKLYDRDGNGVLDSSEVDRIIAQMMHAAEYLGWDVSELRPVLKDMMTAIDADSSGTVSL
EEWVEGGMNNIPLLVLLGLKMTQTDGQHLWRMKHFNRPVYCNVCQSLLLGLRKQGLCCTC
CKYTVHGRCANRNPAPCTRTYVKSKKDIGVPAHDWVSGNCDSKKCDKCQKKIKSFQGLTV
KHCVWCHTMRHDECADQEPTECSCGLLRDHILPPWAIYPVVKERPNSVKNGCSAEDSDLN
TTPDGQVLQISPVANTHPLLVFVNPKSGGKQGERVLHKFQYLLNPRQVYNLSSGGPGPGL
SFFRNLQDYRILVCGGDGTVGWILDAIDKSNLLARPPVAVLPLGTGNDLARCLRWGGEGY
DGEDLTRILKDIEGSSLVQMDRWSVQVTTDEGQDEGDPVPYEIINNYFSIGVDASIAHRF
HTMREKHPQKFNSRMKNKLWYFEFATSETISASCKKLSESLTMECCGVPLDLSALSLEGI
AVLNIPSMHGGSNLWGETKKADTKGPTSQAEPEVITDPEILKVASQDLSDRRLEVVGLEG
AMEMGQIYTGLKSAVRLAKTSQITIRTKKALPMQIDGEPWMQPPCTILITHKNQASMLMA
PQAKSSGFFT
Download sequence
Identical sequences H3D4P9
ENSTNIP00000015487 ENSTNIP00000015487 99883.ENSTNIP00000015487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]