SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015489 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015489
Domain Number 1 Region: 11-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.17e-103
Family Ankyrin repeat 0.00000199
Further Details:      
 
Domain Number 2 Region: 407-768
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-70
Family Ankyrin repeat 0.0000246
Further Details:      
 
Domain Number 3 Region: 649-1011
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.23e-64
Family Ankyrin repeat 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015489   Gene: ENSTNIG00000012520   Transcript: ENSTNIT00000015695
Sequence length 1063
Comment pep:known_by_projection chromosome:TETRAODON8:9:8751157:8758382:1 gene:ENSTNIG00000012520 transcript:ENSTNIT00000015695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLNITDQPPLVQAIFNRNAEEVQLLLHKKEDVNALDQERRTPLHAAACVGDVHVMDLL
IESGATVNAKDHVWLTPLHRAAASRNERAVGLLLRRGAEASARDKFWQTPLHVAAANRAT
RCAEALLAHLSNLNMADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAMDKKERQPVHCA
AYLGHVDVVKLLVSRSADKSCKDKQGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNGFGN
TPLHVACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVN
QQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDKYGNTPLHIAAKYGHELLISTLMT
NGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFDINTPD
NFGRTCLHAAASGGNVECLNLLLSSGTDLNKRDIMGRTPLHYAAANGRYQCTVALVSAGA
EVNEPDQIGCTPLHYAAASQAFSRVDRHFSGNHDDSNEEEAKESYFCLEHLLDNGADPSM
VNAKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIESSIPVSPLHLAADKGHWQALHVLT
ETAAYVDMQDAAGRSVLYLAAQKGYTRCVEVLLAQGASCLLNENRLMWTPIHVAAANGHS
ECLHMMFDYGEEGDLTNVADKYGQTPLMLAVLGGHTDCVHFLLEKGALPDTKDKRGRSAL
HRGAVLGHDDCVTVLLEHQASALSRDAQGSTPLHRAASGGHTKILASLLQAAMATDPQDQ
LLDNQQYTPLHWAAYKGHEDCLEVLLEFKTFIHEEGNPFTPLHCALMNGHSGAAERLLES
AGAYMLNTRDAKGRTPLHAAAFAEDVAGLQLVLRHGAEINTVDKSGRSALMVAADKGHSG
TVAILLHRAKADLTLLDENRNTALHLACSKAHEMCALLILGEIHSPTLINATNSALQMPL
HLAARNGLATVVQALLSRGATVLAVDEEGHTPALACAPNKDVADCLALILSTMKPFPQRA
GLNLLKHCGITATCAPLPSNGLHNGYVKDRHGAPVGLDGCLSE
Download sequence
Identical sequences H3D4Q1
ENSTNIP00000015489 99883.ENSTNIP00000015489 ENSTNIP00000015489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]