SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015500 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015500
Domain Number 1 Region: 308-498,602-820,851-880
Classification Level Classification E-value
Superfamily Ras GEF 5.75e-99
Family Ras GEF 0.00027
Further Details:      
 
Domain Number 2 Region: 59-189
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-31
Family DEP domain 0.0000267
Further Details:      
 
Domain Number 3 Region: 183-311
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-25
Family cAMP-binding domain 0.00000335
Further Details:      
 
Domain Number 4 Region: 513-611
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-24
Family Ras-binding domain, RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015500   Gene: ENSTNIG00000012531   Transcript: ENSTNIT00000015706
Sequence length 881
Comment pep:known_by_projection chromosome:TETRAODON8:9:8640567:8648038:1 gene:ENSTNIG00000012531 transcript:ENSTNIT00000015706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRMEMHLFRSYRYRVFPDRLSVETPTIRGISWTPLPESLDPKCSMKQFLSDRIVKAARS
VYSVMVEKNPGLIRDRKHHLKTYRQCCSGKELVDWLLKQSECLQSRSQVVGMWQVLVDEG
ILLHDKVKQELNFHDKDAQFYRFRDDGCSPNHVTNEREAEEELQEGLSLLAQLGPDALLT
MILRKCPSQRSAEDLEVIYEELLHVKAAAHLSTSVRKELAAVLLFESHAKAGTVLFSQGD
KGTSWYIIWKGSVNVITHGKGLVTTLHEGEDFGQLALLNDAPRAATIILREDNCHFLRVD
KQDFIRILKDVEANTVRLEEHGKSVLVLEKSSDTAAADRSRQQLQVRYTVMSGTPEKILE
HLLETVKLDSSGSDAVDACVSDFLLTHRVFMSSSQLCSALQLQYPDAEPSEGSDQDKASY
VLATKQRVVKLVCHWVALYGLLLKDDPVALDFLEKLKKEVGADFRLSSIVKEQFRERRRT
RILENGYQSLSRRQQNQNFDWFSHCEEPVGRLQPIRARDKVLWEISRPDGKALALMLPVD
ASVQDVISAVGKPGGDQVLVRMNSAGERAELKLDAAAVFTALGVNERLFLCSSSQVEKLF
PLKEQQGPERGTADILEQMSSKDVAAELTNYDWELFTAMHEVELIYYVFGRHKFPGAVTA
NLERFVRRFNEVQHWVATDLCLCTDLVKRALLLKKFIKIAAVLKEQKNLNSFFAVMFGLS
NSAVRRLHKTWERIPSKTKRVYCSYERLMDPSRNHRAYRLTVAKLGPPYIPLMPLLLKDM
TFINEGNANHVDKLVNFEKMRLMARTVKVVRGCRSQPYTAPSSPQRSLADRVFLEGPATR
MSTCSEHGLLRSPGNIRHYIQNLKVIDNQRQLTQLSRTLEC
Download sequence
Identical sequences H3D4R1
ENSTNIP00000015500 ENSTNIP00000015500 99883.ENSTNIP00000015500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]