SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015507 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015507
Domain Number 1 Region: 22-93
Classification Level Classification E-value
Superfamily UBA-like 0.00000204
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015507   Gene: ENSTNIG00000012538   Transcript: ENSTNIT00000015713
Sequence length 458
Comment pep:known_by_projection chromosome:TETRAODON8:9:8595266:8599851:1 gene:ENSTNIG00000012538 transcript:ENSTNIT00000015713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKNSQKDTSGVVFDTRSKMVMWQGGTTERMKEKISAVRAVVPNKSNNEIVLVLQHFEN
CVDKAVQAFLEGSAAEILKEWNVTGKKKPKKKKKPKPQPEAPAQPAPPEATPPGDSKDEV
NGFHANGSAMDGESLDSLSEQLDSASLDAAELDSEPASSETAGNKPRHRPGAASHPPASS
LAPAPDEHGSGAKKIAPNIDRSVKDLQRCTASLTRYRMVIKDEMDSSIKSMKQTFAELQS
CLMDREVTLLREMDKVKSETMLTLETRQKRAEELRRLTDRSASMSEEQRSELRAEIKHFV
SERKYDEDLGKAVRFTFDLEPLKSSITGFGSVYHPRTGYSNRSRCSSTSSSVTSPSLQET
PPPPPTQTQSPPSETRPPPNKQIFQGNRRTFQGQGYHSGSQRYNGGHGDRNPGRPNHRYQ
SEGGSHAHPRAPPRSSAHNHDRSAHNGLPQRLPRTHCP
Download sequence
Identical sequences H3D4R8
99883.ENSTNIP00000015507 ENSTNIP00000015507 ENSTNIP00000015507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]