SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015532 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015532
Domain Number 1 Region: 208-359
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-32
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 98-207
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-22
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 12-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-20
Family First domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015532   Gene: ENSTNIG00000012563   Transcript: ENSTNIT00000015738
Sequence length 914
Comment pep:known_by_projection chromosome:TETRAODON8:9:8145602:8153900:1 gene:ENSTNIG00000012563 transcript:ENSTNIT00000015738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNHFSLQMTEGRLCQVQLLDDRKLELLVQPKLLSYELLDLVSSHFNLKEKEFFGLAFL
NDHGQRKWLQMDRRVLDHDFSKKAVPVTLSFLVRFYVENITHLKDIVTIELFFLNAKCAV
YNEIIEVESENVFKLAANALQEANGDYTSDENARADMKKLPTLPTKVLKEHPSLAYCEDR
VIEYYKQLKGVSRGQAIVQYLTLVESLPTYGVHYYEVKDKQGMPWWLGISYKGIGQYDLQ
DKLKPRKLYQWKQLENLYFREKKFAVEVNDPHRRAVTKRTFGQTGLQIHTWYASHSLIKT
IWVMAISQHQFYLDRKQSRAKLGSVRSLEEIAMDLTEHSGAKMNRLGEACLKNNLITAST
GSLVSTGSADSEMSEEQKKEKLSELRKKEQEIRDILTKKTKELKKICMREAELTGKLPKE
YPLSSGERPPQIRRRVGTSFKLDDLFPYNEDPFLRNLESRFALQQKIVEAAKKLANEPEL
CKTVKKKRRRNCLDAMHKLQQIEDEMNQYRIKMGKKPTQRASVIIADELNRSDCGSLSSL
PLDDDDSDANRRPRSRSVQGSPQLSPMRSLGADYDVDTLGSQRENHHNKSHSREVSSTHS
SPYKTLPRPPREPHSMPPTPVMTRNAYSSSHLRSEGSPHCFRHRSGSLESQPRLRKDADT
EKPVFMLSPAHRSNSTEVLEDGSSYTSQSSLEYCGATNSHYSTLDSRSSTVHRLHRKLDV
YGNTGSMPNLVQHHSGCSYPCEPYAPSAYFVSGYPSPDMEPYANGAYMYENEVEGHYNVN
PSYQMNGYHGHDRFRHYGGDRADSLSQNPYATMRPPRSREGPRNELLAKNMQKALVAEHL
KGWYHRSKGHREGGRAMLTGYDFDSGSQLSLGYQTMPAAIGHSSRTTSFSSVSSAESSGN
WRNQLAVGLTEHDS
Download sequence
Identical sequences H3D4U3
99883.ENSTNIP00000015532 ENSTNIP00000015532 ENSTNIP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]