SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015547 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015547
Domain Number 1 Region: 23-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000245
Family TAP-C domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015547   Gene: ENSTNIG00000012577   Transcript: ENSTNIT00000015753
Sequence length 288
Comment pep:known_by_projection chromosome:TETRAODON8:9:7855138:7858234:1 gene:ENSTNIG00000012577 transcript:ENSTNIT00000015753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGMDLDLDQELMQKFSCMGTTDKDILISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNINAPCMSFVRDVTIGEGESVPPDTPFTKTWRIQNTGAESWPPGVCLKYVGG
DQFGHVNMVMVRSLDPQEMTDVSVQMQSPTSPGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFQAEFNTQPHRPLEGDYNPFASPEKSKCPNSNSLHDASSHVVPEEHW
QGSPSELQQDQNGLSHSSVDIVASSLQTNLSLVSYNKGIKEPYPFGNS
Download sequence
Identical sequences H3D4V8
ENSTNIP00000015547 99883.ENSTNIP00000015547 ENSTNIP00000015547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]