SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015552 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015552
Domain Number 1 Region: 781-888
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-22
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 2 Region: 257-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 3-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 219-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 638-776
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 137-256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015552   Gene: ENSTNIG00000012581   Transcript: ENSTNIT00000015758
Sequence length 966
Comment pep:known_by_projection chromosome:TETRAODON8:9:7745336:7784361:-1 gene:ENSTNIG00000012581 transcript:ENSTNIT00000015758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAEGLDNCSIDAICQNTVKSYKCICKSGYKGDGKHCEDVDECVTEYNGGCVHECIN
IPGNYRCTCYDGFRLAHDGHNCLDVDECSEGNGGCQQICVNMMGSYECRCREGFLLSDNQ
HTCIQRPKVQMEGTKEGPTCMDKNHGCAHICRETQKGGIACECRPGFQLTRNMKDCKLTC
NYGNGGCQHICEETDHGPKCSCHMKFVLHSDGKTCVETCAVNNGGCDSTCHDSVTGVRCS
CPVGFTLQPDRKTCKDIDECRLNNGGCDHVCRNTVGSFECSCKKGYKLLTNERTCQDIDE
CSFDRTCDHFCVNSAGSFQCLCDKGYVLYGLAHCGDIDECSINRGGCKYGCINSLGSYEC
TCPPGYKLHWNRKDCVELVKCPPGLVAPKATLTCNKTGKKESCSLTCASKAHYLAESDNS
YSVSCGIPILRGKSPARLNSSTSQGCIETLAPPVKQTASFKIKNAKCHLHPKLSGRTEDR
GRTLGPGSAQPCSNCLVTFVNLKCDSSKKAKGRRARNPSNKEVTRITLELEAEVKPGDTT
GSCNLSCLRQRMEKQVKTYIKALKKSINQERFLIRVAGLEYEVAQKLPQAAPVQENCGPG
WERDGSRCVRCSSGSYYHGEQERCVLCPPGTFQEKEGQLACDLCPGSDGHGPVGARNISS
CAGQCPMGYFSGDGFKPCQPCPQGAYQPDLGRTLCFPCGGGLSTKREGASSFHDCEVKVQ
CSPGHYYNTTVHRCIRCPVGTYQTEFRQNYCISCPGNTTTDFDGATSVSQCKNRQCGGEM
GEFMGYIESPNYPGNYPANVECIWNINPPSKRKILIVVPEIFLPSEDECGDVLVMRKNWS
ATSITTYETCQTYERPIAFTARSRRLWINFKSNEVNSARGFQIPYVTYDEDYEQLVEDIV
RDGRLYASENHQEILKDKKLIKTLFDVLAHPHNYFKYTTRESNEMLPRSFIRLISSKVSA
FLRPYK
Download sequence
Identical sequences H3D4W3
ENSTNIP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]