SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015560 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015560
Domain Number 1 Region: 74-382
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.5e-114
Family Glutaminase 0.00000594
Further Details:      
 
Domain Number 2 Region: 405-491
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.31e-16
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015560   Gene: ENSTNIG00000012589   Transcript: ENSTNIT00000015766
Sequence length 493
Comment pep:known_by_projection chromosome:TETRAODON8:9:7647688:7651797:-1 gene:ENSTNIG00000012589 transcript:ENSTNIT00000015766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEMITLTQFTSALRKTGLLTSDPRLRDCVHVMRQSLRASVGPVMMDKALFRRCVGNNIML
LANAFKGKFIIPNFADFTQQMDKMYESAYQEEAGQVADFIPQLAKFSPELWGVSLCTVDG
QRHSAGDTKVPFCLQSCVKPLAYAVALHHLGTERTHQFVGKEPSGFRFNKLSLNDQDKPH
NPMVNAGAIVISSLIKPNLNKAERFDFVMEFLKRMAGMENVGFSNATFQSERETGDRNYA
IGYYLKEKKCFPENTDMTAALDFYFQLCSIEVTCESGSVMAATLANGGICPITGERVLST
EAVRNTLSLMHSCGMYDFSGEFAFHVGLPAKSGVSGAVLLVVPNVMGVMCWSPPLDRSGN
SVRGIHFCQQELVSRFNFHNYDNLRHFTKKYDPRRTSHYDQNKSLVNLMFAAHSGDVSSL
RRFALSSVNMEQQDYDSRTALHVAAAEGHVEAVIFLTNTCKVNPNIRDRWGNTPLDDALQ
FGHEVVVSVLKEY
Download sequence
Identical sequences H3D4X1
ENSTNIP00000015560 99883.ENSTNIP00000015560 ENSTNIP00000015560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]