SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015574 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015574
Domain Number 1 Region: 172-282
Classification Level Classification E-value
Superfamily Bromodomain 1.05e-27
Family Bromodomain 0.00043
Further Details:      
 
Domain Number 2 Region: 290-419
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.79e-21
Family PWWP domain 0.009
Further Details:      
 
Domain Number 3 Region: 100-154
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000535
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1034-1076
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000453
Family MYND zinc finger 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015574
Domain Number - Region: 934-1033
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0955
Family Apolipoprotein A-I 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015574   Gene: ENSTNIG00000012603   Transcript: ENSTNIT00000015780
Sequence length 1133
Comment pep:known_by_projection chromosome:TETRAODON8:9:7453636:7460061:-1 gene:ENSTNIG00000012603 transcript:ENSTNIT00000015780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAEDEVKTEADVVEAMDASVRSKVPDPSGSADRPLVPQKRKVSSPTHSSNGHSPTDTSP
SPLKKKKKPGVVNSNSKDQSELRHGPFYYMKQPALTTDPVDVVPQDGRNDFYCWLCHREG
QVLCCELCPRVYHAKCLKLPAEPEGDWFCPECEKITVAECIETQSKAMTMLTIDQLSYLL
KFALQKIKQPGTEPFQKPVSLEQHPDYAEYIFHPMDLCTLEKNIKKKMFGCTEAFLADMK
WILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSSCQKRENWFCEPCSQPH
PLVWAKLKGFPFWPAKALREKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSI
FNSAMQEMEIYVENIRKKFGVFNYAPFRTPYTPNNQLQMLLDPSNPGAGAVKTEKADKLR
FNFDITASPKMVLSKTSTPSMSRRVSTTDVPRSPMSTTSSVHTGSDGEDMEKTTRNPSFH
YSTGEESMDCTAIASPVSGKMGPAGSVTASPKAFNPGLVPKQERNTGTGSILNLNLDRVK
AEMDLKELSETVQQQQQQQSQQSGGPVSHTTPKRPIRSLDKTIESCKAQLGIDEISEDVY
KGVDHSDSEDSEKSDSSDSEYLSDEEHKPKSSNLDDKDKAEKKWPKASADGDTKDGVAGK
AAPETAPKDKQARNGPERDLQDKPAMPQTQPATEKPKAPEEGRAAAAKSAAEQDSDSERE
LVIDLGDEQGGPDSKKARRDAGASTAKPSKESSVAKVEATTPSRDAALNQKDPAVAAVLN
SAASSQTSASPAASVSSSTPTPASASVSAAAPAPLKKQRPLLPKETAQAVQQAVVWNPSK
FQTSSQKWHMQKVQRQQGEQSAAQTQSPGQTRSPQHPQSQQQHTRYQTRQAVKAAVQQKD
VPQNASSTAGQASSSSPLMTGDVQIPTVSADVAADIAKYTNKIMETIKGTMTEIYSDLSK
STTGNTIAEIRRLRIEIEKLQWLHQQELSEMKHNLDAELTMAEMRQSLEQERERLVAEVK
KQMEAEKQQAVDETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATA
SQQETETEPNSDPSVKPSGHSPGTQPPAAGSITDKSNSPSYTEKSKDSAGVTV
Download sequence
Identical sequences H3D4Y5
99883.ENSTNIP00000015574 ENSTNIP00000015574 ENSTNIP00000015574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]