SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015578 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015578
Domain Number 1 Region: 81-188
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-27
Family Cadherin 0.00000615
Further Details:      
 
Domain Number 2 Region: 306-434
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-24
Family Cadherin 0.00041
Further Details:      
 
Domain Number 3 Region: 194-311
Classification Level Classification E-value
Superfamily Cadherin-like 7.13e-17
Family Cadherin 0.00055
Further Details:      
 
Domain Number 4 Region: 420-530
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000757
Family Cadherin 0.0043
Further Details:      
 
Domain Number 5 Region: 7-87
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000393
Family Cadherin 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015578   Gene: ENSTNIG00000012607   Transcript: ENSTNIT00000015785
Sequence length 730
Comment pep:known_by_projection chromosome:TETRAODON8:9:7174566:7195006:-1 gene:ENSTNIG00000012607 transcript:ENSTNIT00000015785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMQIRSDQDQDISIRYSITGMGADQPPNEVFNIDPVLGMFVTKPLDREHRSSYHLRAHAV
DMNGNQVENPIDLYIFVIDMNDNRPEFKNQIYNGSVDEGSKPGTYVMHVSAFDADDNTTA
NGMVRYRILSQMPHSPIPNMFTINSETGDIVTVASGLDRENVPQYTIIVQATDMEGNLNF
GLSNTATAITITDINDNPPHVDLQDDFSGEVPENKVDVVVANLTVIDADQPHSPNWNANY
RIISGDPTGHFTIRTDPVTNDGMVTVVKPVDFERNHAFMLTVVVSNQAPLASGIQSSLQS
TAGVTISVQDVNEPPYFPTNPKHIRFEEGVPAGTSLTTFSASDPDRLQMQQTIRYSKLND
PADWLSINRSNGQIITTAMLDRESIYVKNNIYEATFLATDNGSPVASGTGTLQIYLIDIN
DNSPALIPKESQICERTSRNVNSVNITAADEDTDPNAGPFVFELPNFPTSIRRNWTISRI
SGDYARLGLRYQVYLEPGVYEVPVIVSDSGNPPLSNRSVIKVKVCPCDEHGDCTTLGAVA
AAGLGTGAIISILICIIILLSMVLLFVMWIKRREKERQNKQLLIDPEDDVRDNILKYDEE
GGGEEDQDYDLSQLQQPDSLEHIISKPPGVRRVDERPIIPESQYPIRPVVPHPGDIGDFI
HEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSTGDQDYDYLNDWGPRFKKL
ADMYGGGVED
Download sequence
Identical sequences H3D4Y9
99883.ENSTNIP00000015578 ENSTNIP00000015578 ENSTNIP00000015578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]