SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015584 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015584
Domain Number 1 Region: 330-460
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 101-211
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-18
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 213-338
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000443
Family Cadherin 0.00048
Further Details:      
 
Domain Number 4 Region: 447-547
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000408
Family Cadherin 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015584
Domain Number - Region: 41-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.00134
Family Cadherin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015584   Gene: ENSTNIG00000012612   Transcript: ENSTNIT00000015791
Sequence length 617
Comment pep:known_by_projection chromosome:TETRAODON8:9:7139821:7142595:1 gene:ENSTNIG00000012612 transcript:ENSTNIT00000015791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRNKRRWVLSTIELEEEDPGPYPKPISKVYNNLPRTNYEFRISGQGVDEEPINTITVNP
ETGEVSALRCIDREQYGQPFHFGTKEVLDKQLAFDIEIIDINDNTPTFTLPHTIEVKENT
PPGSLLERLEVIDKDQEQTDNSRITVSLVSQEPTEPKISMEHVANTQVKLSLKSGCFDYD
KTKQYEVRLKASDAGKPSRSSTTVITLNIVDGNTHPPMFKQTEYKGEVMELQTQMEVLRV
GVEDKDTPKTPGWYAEYFFITGNEEGHYKIETDNETNEGVLTVVKGNDYETMTYVRLEVG
VKNKEPLWVCKENPTDSRNKDFYDSVMITVKVKDVNDPPTFPQDPVILHMVEEEKPGKVL
FKPEVKDVDSDESEIRFVLIDDPENCVSIDRKTGKVTLVKTIDRESPALNGTGIYSIVIG
AVDNGSNPEEPPATGTCTVQIHLQDINDNKPELVNKGVTICGNRDNKVIVAARDADDIPY
GGPFYFSLKNDEKILKQWTLDPSFGHECGLVSKKALHYGNYSVPLEIRDQQNILAEETLE
VMVCDCEEKNVCRSKKKTGTSLGSAGIGMAFVGILLFLLLLLIFSCQCRKAFKTMPFVQE
EGYQNIIKYNEEGGMSE
Download sequence
Identical sequences H3D4Z5
99883.ENSTNIP00000015584 ENSTNIP00000015584 ENSTNIP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]