SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015606 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015606
Domain Number 1 Region: 10-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.48e-16
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015606   Gene: ENSTNIG00000012634   Transcript: ENSTNIT00000015813
Sequence length 346
Comment pep:known_by_projection chromosome:TETRAODON8:3:8859110:8861192:1 gene:ENSTNIG00000012634 transcript:ENSTNIT00000015813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSISLDKELQERLREASAIGDIDEVRTLVESGVNINSQNEINGWTCLHWACKRNHKHIV
TYLLACGADIEILTAKDELASQLTSKPEIKRLLGVEVEEVPEVKEPELPIIPNYLSNPPF
IYSKLDNKSELITDQHVTQNGSGVREEDSEPASLSPTLEPQESPSMRSDPPAAVSNPSPH
ATEFLPVAEQNVQAPVAGPNPAMSRQQSIPQQLGHSQPGGAVPAFQPFFFTSTFPVNVQE
LVLKVRIQNPSARENDFIEVELDRQELTYRSLLRVCCRELGISAEHVEKIRKLPNTMLRK
DKDVARLQDFQELEVVLEKAEGLSFFSGGGLTDRPCYNMKASRLTY
Download sequence
Identical sequences H3D517
99883.ENSTNIP00000015606 ENSTNIP00000015606 ENSTNIP00000015606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]