SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015612 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015612
Domain Number 1 Region: 255-493
Classification Level Classification E-value
Superfamily vWA-like 2.88e-33
Family Integrin A (or I) domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015612   Gene: ENSTNIG00000012640   Transcript: ENSTNIT00000015819
Sequence length 953
Comment pep:known_by_projection chromosome:TETRAODON8:19:949792:954589:-1 gene:ENSTNIG00000012640 transcript:ENSTNIT00000015819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPLLPLLLGLLLLQQGRCFLEFVIHEETSNPQSRQQRHQVRVQVFQRALLTSEEPDDF
EAIRGDDISVQSYQVESRITSRFVHTSVRSAVLNSAPRAQSIGFNVQVPKRAFITNFTMN
VNGIVFVGSVKEKTVARNLYAQARARAKAAGIVRTGSLDMETFQTEVHVPPGSNIQFELH
YQEMLSRRLGLYQHTLHLQPGRLVPHFQVDVHIFEPSGISMVQTKQALAKEFNDFVSVTR
SKNTAHVVFKPPLQQQKKCPNCTETAVDGVFAVQYDVERAGNAAELQVSDGHFVQFFAPS
NFPPLRKNIVFVIDVSGSMWGVKMKQTVEAMQAILDDLTVDDSFSIVDFNHNVRCWSEDL
VPGSSVQVKDAKTYIENIKPNGGTNINEALMRAVQMLVRASHQGLVDPRSVSMIILVSDG
EPHRGGEIKLSAIQKNVKRAMREEFSLFSLGIGFDVDFDFLERIATENRGVAQRIYANQD
TADQLRSFYRQVAAPLLRRIDVQFPEDSVSDVTQNRFDKYFEGSELVVAGKVLPSESNTL
TSFITASAARLDVSLQTDADAAELDAELARQEHSFTGFARQLWAYVTVKQLLSDRSLAPS
AARKRKITQRIMAIALEHQFVTPLTALLVESEDASERLLADAPKDPKHGCCTGLGLGGGS
VAPGPPPVRVVYQPPPWVQMTTPAPPSQVEGGQVEQTLPGRVTIVDNDPHFIVHLPRGNM
DVCFNVNSRPGDILNLVSDSGTGLTVNGQLIGSKKMRANKLDTYFGTISIFYRPGGVGVT
VGTAGVQVTDGRSNRSLAWAATSAITRDSVRVSVVKDSHVSVTVGANIQVMVLLHRVWKK
HPVNVDFLGIYVASENQYSPLVHGLIGQFSREPEVRIHHIQPGVDPLKKEAVMEVKGNRL
HVTSRGWQKDYRRDRRSGSNVYCWFVHNSGKGFIDGHYTDYIVPELRSFLRRP
Download sequence
Identical sequences H3D523
ENSTNIP00000015612 ENSTNIP00000001708 99883.ENSTNIP00000015612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]