SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015621 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015621
Domain Number 1 Region: 242-564
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-55
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 733-840
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-18
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015621   Gene: ENSTNIG00000012648   Transcript: ENSTNIT00000015828
Sequence length 868
Comment pep:known_by_projection chromosome:TETRAODON8:19:1049540:1062910:-1 gene:ENSTNIG00000012648 transcript:ENSTNIT00000015828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAISRSGLQHLGPPQPSSPPASNGPNKELRSCLDWTENAANGDHLWMETSCSGELCYLG
EDNCLLKTASFKKSTPRRKCAACRIVVHTGCMEQLEQINFRCKPTFREGGSRCLRDQNML
RHHWVHRRRQEGKCRQCGKSFQQKFFHSKEIIAISCSWCKLAYHNKVTCFMLHQIEEPCS
LGAHAGVIVPPSWIIKVRKPQSSLKNSARRKKRTSFKRRTSKKGLDESKWRPFIVKPLPS
PLMKPILVFVNPKSGGNQGAKLLQMFMWILNPRQVFDLSQGGLREALELYRKVPNLRILA
CGGDGTVGWILSTLDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKVLCHVED
GAVVQLDRWNLLVEKSTTQPEEGTQKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFN
SRFRNKMFYAGAAFSDFLQRSSRDLSKHVRVVCDGTDLTPKIQELKFQCIVFLNIPRYCA
GTMPWGNTGDHRDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVVLTTFKTV
PVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLKSPHAIPDRLRLRVNRISLQE
YDRLQYDKERLRDISIPVGIVVVRGDCDLETCRLYIDRLQEDESRGVPRTSSSSRLSSNW
SFLDSTSADRFYRIDKAQEHLHFVTEICQDEVFILDHEGPVVSQGVSTGMPDLVVEPTTG
TPLTSDEQVCAFPALLTAAGAGDVATMSECVRRGVSLLVRDSGGCSALHIAAQKGHAELV
SFILQQGSKALLDLADREKGDTALHKAASGKLHAVCRLLVEAGASLKKTNFQGKTAADQA
EGDAELATFLSGQRQTSSNNRDDLETAV
Download sequence
Identical sequences H3D532
ENSTNIP00000015621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]