SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015625 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015625
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-58
Family Ankyrin repeat 0.000000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015625   Gene: ENSTNIG00000012652   Transcript: ENSTNIT00000015832
Sequence length 1025
Comment pep:known_by_projection chromosome:TETRAODON8:19:1105790:1128959:1 gene:ENSTNIG00000012652 transcript:ENSTNIT00000015832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRML
DHGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASIDQPDNEGWLPLHAASSCGYLD
IAAYLISQGANVGGVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERVMLRD
ARQWLNSGQIQDVRHAKSGGTSLHVAAAKGYVEVLKTRRLLIQAGYDVNIKDYDGWTPLH
AAAHWGKEEACRILVENLCDMDLINKMGQTAFDVADEDVLGYLEELQKKQNLLMSSKKDV
KKSPLIETTTTGDNNQSLKPLKSKETLLLEPEKSTPRIETLEPEKVDEEEEGKKDESSCS
SEEEEDEDSESETEAEKTKPSSASVSNSTTTTSTSTVSPPTSPTNQVTSPTSPIKKATQP
AGKATAKVDEERKDESPASWRLGLRKTGSYGALAEITATKEAQREKDTSGVMRSASSPRL
SSSLDNKDKEKEKDKGTRLAYVAPTIPRRLASASDIDEKENRDSPALIRSGSYTRRRWDD
DLKNSEGSNRTSSYQRSGSFGRRHEDLSSTTSSPSSSTTTTTSSSVTSTAGLRGLGSSAR
TGSTSLTSRYWSEESAPTNPDTFPVWEQGVCVCVRVQAVHTRSLCRVSPPACVFKWVECV
FVCVRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRPIKTHTE
IKEEDYRSKYRSYEEVRPGLGCFLHLDRLKLSSRLISFLFSRLPQRYRPLSSSSSSTSAI
STASTASTPSYSSTTLSSSSLNRPNSLTGITSSYSRSSRDTEKETDRKEEEKEGEDKSQP
RSIRDRRRPREKRRSTGVSFWTQDGEENDPEQQSDSEEGGNKGEPQSDRLSRNELTSDRN
DSLSSRGYGESRRIYSSRLDRDDATDYKKLYEQILAENEKLKAQLRDTDLELADLKLQLE
KATQRQERYADRSQLEMEKRERRALERKISEMEEELKTLPDLKADNQRLKDENGALIRVI
SKLSK
Download sequence
Identical sequences H3D536
ENSTNIP00000015625 99883.ENSTNIP00000015625 ENSTNIP00000015625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]