SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015635 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015635
Domain Number 1 Region: 202-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.4e-26
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 541-648
Classification Level Classification E-value
Superfamily POZ domain 6.75e-23
Family BTB/POZ domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015635   Gene: ENSTNIG00000012662   Transcript: ENSTNIT00000015842
Sequence length 738
Comment pep:known_by_projection chromosome:TETRAODON8:19:1359678:1377610:1 gene:ENSTNIG00000012662 transcript:ENSTNIT00000015842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGALSLPDSLNLHRDQQRSGRGGECQGYTQAELRTLEQSLLATRVGSIAELSDLVSRAMH
HLQPLHIKNSGNGTPVHQKSSTTTVHWEPEALYTLCYFMHCPQMEWENPNVEPSKVTLQT
ERPFLVLPPLMEWIRVAVAHTEHRRFSVDSDDVRQAARLLPGVDCEPRQIKAEDCFCATR
KLDAASTEAKFLQDLGFRMLNCGRTDLVKQAVNLLGPDGINSMSEQGMTPLMYACVRGDE
AMVQMLLDAGADINSQVPSTVNKHPSVYPETRQGTPLTFAVLHGHVPVVQLLLDNRADVE
GAQQDGAENYAETPLQLAAAAGNFELVSLLLERGADPMIGTMCRNGISSAPLGDMNSFSL
AASHGHRNVFRKLMAQSDKEKGDVLSLEEILAEVRTPGEKRPAPQANSGGTLRTGKAKLR
ALREAMYHSAEHGHVDITIDIRSLGVPWTLHTWLETLRTCFVQHRRPLIQGLLKDFSCIH
EDEYTEELLTHGLPLMFQILRVCKNEVISQQLSVIFTHCYGPFPIPKLTEIKRKQTSRLD
PHFLNNKEMSDVTFLVEGKPFYAHKVLLFTASARFKSLLQNRPAAENTCIEISHVKYNIF
HLVMQYLYCGGTESLHIRNTEVMELLSAAKFFQLEALQRHCEIICSKNITTETCVDLYKH
ARFLGASELTAFIEGYFLKNMVLLIELDSFKQLLYEPPPPESPVSSPGIYSDILQDLEKT
LAMRIRSIHLSTSKGSVV
Download sequence
Identical sequences H3D546
ENSTNIP00000015635 ENSTNIP00000015635 99883.ENSTNIP00000015635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]