SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015655 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015655
Domain Number 1 Region: 808-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 333-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000893
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 3 Region: 964-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 4 Region: 507-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 269-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Laminin-type module 0.056
Further Details:      
 
Domain Number 6 Region: 918-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.095
Further Details:      
 
Domain Number 7 Region: 760-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 9 Region: 1073-1115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 10 Region: 1016-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 11 Region: 854-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 1121-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 13 Region: 415-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 14 Region: 92-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000829
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015655   Gene: ENSTNIG00000012681   Transcript: ENSTNIT00000015862
Sequence length 1776
Comment pep:known_by_projection chromosome:TETRAODON8:19:1595575:1606736:-1 gene:ENSTNIG00000012681 transcript:ENSTNIT00000015862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEIHVLTTLALCCCVRALRPQLQASVCAEGSCYPATGDLLIGRARRLAASTCGLRGPQ
RFCIVGHLEEETKCFTCDSREPYEEDGNHISHTIENVVTTFAPNRLKTWWQSENGVENVT
IRLDLEAEFHFTHLIMTFKTFRPAAMLIERSMDRGNTWQVYRYFAANCEASFPGVSTGPL
SRVDDIICDSRYSDIEPSTEGEVIFRVLDPAFEIEDPYSLRIQNMLKITNLRINFTKLNT
LGDNLLDSRDEVTEKYYYSLYDMVVRGNCFCYGHASECQPIHDPSPEEEGMVHGRCVCKH
NTDGVNCERCQDFYNDLPWKPAVGRHTHTCRKCECNQHATTCHFDMAVYMTTGNVSGGVC
DDCKHNTMGRQCELCAPFYFQHPNRDPRDPNVCEPCNCDPDGSLQGGLCDAHTDVVAGLI
SGQCRCKANVEGERCDNCRQGYFGMGRGPDGCLPCACNPLGTLPRGSPCDSHTGSCFCKR
LVHGNACDQCVPEHWGLSNDMDGCRPCDCDHGGALNNNCDPHSGQCVCREHMLGRRCDQM
EPGFYFVALDHYTYEAEDAKHGPGVKLVPRPRPRDRRPTWTGMGFVNMPEGTHLEFTVDN
VPESMDYDVLLRYEPQLPDQWEKVTVQVQRPVQSGHCSHSIQSGDEQSVSLPPGSRHVLL
PRPVCLEEGLTYALRLSLPLYSSVSHIQNPYTLIDSLVLIPRLGGLKMFHGVEGGAAWDT
FQRYRCLESSQSIIKSPITDICNSYIFSVSALLHKGAVACQCDPQGSLSALCEASGGQCQ
CRPNVVGRNCDSCAPATYRFGPSGCRACECDPRGSATSFCHQETGQCTCLPGATGRQCSH
CLPGHWGFPQCRPCHCNGHSDSCHPQTGQCQGCRDFTTGHHCERTPRCLDGYHGDPELGS
GGHCRPCTCPDGPRSGRHFSDSCYVLAQQLVCVCSPGYKGPRCEECAPGYFGNPSVPGGR
CVPCQCNNNIDMHDPGSCDAQTGACLRCLHHTEGYACQHCKAGYYGNAATQSCRKCTCDP
VGTLPRACSSPEECACDQQSGQCPCKPNVVGQDCDRCAPDTWNMAGGTGCRTCDCDPDHS
FGSSCNEITGRCSCKPGFGGRTCRECREMFWGDPKVKCHACDCDPRGISSEQCHRATGQC
TCTKGASGPRCDQCARGYRGTFPACEPCHQCFAAWDVVVGELSDQTRRLEAQVAELQNSG
AIAPYQELIQRLETNAKAVRDLVESNPAAVQLEAIEELTHQITGVMSFLSGKLNTTEETA
TLLHGDSNATEVHLDALTEDINQLETSVTELRERVYAAKNANFQGALDTISSAHTLSTMA
ESRVNASTSGPGSTLEQSAASRRATEDKMSDSEKEFDRKHQRNAKKLDRLSEELDQLDLT
PLSEQACGGAAQGDGCSGSPCGGLGCTGKDGAPMCGGEECKGFVTAAHTALKSAKDLDQE
IVAAMKEVDKLSSMVWEAKKRANEAKANAMEVLVKSNRSKERVEQSNEQLRSLIKEIRDL
LTNERANVSVIEAVANEVLALEMPTSVEKLQELTREIKEKVGALTSVETILSQSAEDVRA
AEALLKEAAAASEQASTLEETIEMVKAALNKSERAQSAAMDAIQLAQNNTKNTLDLIIYL
ESETAMTELKLSNATGRLILLEGEVGLLRQNSLEVDQLEESAKQISEQAKVKAEEAQKEF
DLDLKDKLEEVEDLVEDKGEMVLQGRRRAEKLQQEAKELLGQSSSKLHRLKELERAYESN
QRVLEDKAEELAGLEKKVRQLLDEISYKVTLYSTCV
Download sequence
Identical sequences H3D566
ENSTNIP00000015655 99883.ENSTNIP00000015655 ENSTNIP00000015655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]