SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015656 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015656
Domain Number 1 Region: 306-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 2 Region: 242-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.056
Further Details:      
 
Domain Number 3 Region: 428-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 369-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 5 Region: 65-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000744
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015656   Gene: ENSTNIG00000012682   Transcript: ENSTNIT00000015863
Sequence length 485
Comment pep:known_by_projection chromosome:TETRAODON8:19:1610334:1614532:-1 gene:ENSTNIG00000012682 transcript:ENSTNIT00000015863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAEGSCYPATGDLLIGRARRLAASSTCGLRGPQRFCIVGHLEEETKCFTCDSREPYEEDG
NHISHTIENVVTTFAPNRLKTWWQSENGVENVTIRLDLEAEFHFTHLIMTFKTFRPAAML
IERSMDRGNTWQVYRYFAANCEASFPGVSTGPLSRVDDIICDSRYSDIEPSTEGEVIFRV
LDPAFEIEDPYSLRIQNMLKITNLRINFTKLNTLGDNLLDSRDEVTEKYYYSLYDMVVRG
NCFCYGHASECQPIHDPSPEEEGMVHGRCVCKHNTDGVNCERCQDFYNDLPWKPAVGRHT
HTCRKCECKQHATTCHFDMAVYMTTGNVSGGVCDDCKHNTMGRQCELCAPFYFQHPNRDP
RDPNVCEPCNCDPDGSLQGGLCDAHTDVVAGLISGQCRCKANVEGERCDNCRQGYFGMGR
GPDGCLPCACNPLGTLPRGSPCDSHTGSCFCKRLVHGNACDQCVPEHWGLSNDMDGCRPC
DCDHG
Download sequence
Identical sequences H3D567
ENSTNIP00000015656 99883.ENSTNIP00000015656 ENSTNIP00000015656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]