SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015738 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015738
Domain Number 1 Region: 33-170
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000771
Family Ankyrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015738   Gene: ENSTNIG00000012765   Transcript: ENSTNIT00000015947
Sequence length 784
Comment pep:known_by_projection chromosome:TETRAODON8:6:4624151:4630765:1 gene:ENSTNIG00000012765 transcript:ENSTNIT00000015947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMAALYQGTDASSPDKYLALKDVREVKEETTLDEKLFLLACEKGDYYMVKKLLEENRNGE
LNINCVDVLGRDAITIAIENENLDILQLLLDHGCQATDALLVAIDSEVVGAVDILLNHRP
RRSSKPSIAKLMQRIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDISLPRPHAVGCE
CTLCNAKNKKDSLRHSRFRLDIYRCLASPSLIMLTEEDPILRAFELSADLKELSLVEVEF
RNDYEELAKQCKMFAKDLLAQARNSRELEVILNHTSSEDHVDKRGLLEERMNLSRLKLAI
KYNQKEFVAQSNCQQFLNTVWFGETASYRRKHTCLKMATVLSVAVLWPLLSVCYLLVPRS
RMGQLIHTPFVKFIIHSASYLTFLLLLNLYSLVYNESKKNTMGPPLGMIDYLLILWIIGM
VWSDVKRLWYQGLEDFLEESRNQLGFVMNSLYLATFALKIVAHSKFKNVGDIERKNWDAF
HPIVVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQEFGKFLGLFLLVLFSFT
IGLTQLYGKDQKDPDKNPSKDCEGIFCQQQSNDAFHTFMGTCYALFWYIFSLAHVALFVT
RISYTEELRSFVGAMIIGTYNIVVVIVLTKLLVAMLHKSFRQIANHEDKEWKFARAKLWL
SYFDDKCTLPPPFNIIPSPKTVCYLLTSMSKWICSHTSKGKVKRQNSLKEWKNLKQKRDE
NYQKIMCCLVHRYLTSTRQKMQSTDQATVENLNDLRQDLSKFRNEMRDMLGFRTSKYAMF
YPRS
Download sequence
Identical sequences H3D5E9
ENSTNIP00000015738 99883.ENSTNIP00000015738 ENSTNIP00000015738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]